| Clone Name | rbags8i02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RL31_NICGU (P46290) 60S ribosomal protein L31 | 57 | 2e-08 | 2 | RL312_ARATH (P51420) 60S ribosomal protein L31-2 | 54 | 2e-07 | 3 | RL31_PICMA (O65071) 60S ribosomal protein L31 | 54 | 2e-07 | 4 | RL311_ARATH (Q9STR1) 60S ribosomal protein L31-1 | 53 | 2e-07 | 5 | RL31_PERFR (Q9M573) 60S ribosomal protein L31 | 52 | 4e-07 | 6 | RL31_PANGI (Q9MAV7) 60S ribosomal protein L31 | 47 | 2e-05 | 7 | RL31_CHLRE (P45841) 60S ribosomal protein L31 | 35 | 0.060 | 8 | RL31_CYAPA (Q9XGL4) 60S ribosomal protein L31 | 31 | 0.86 |
|---|
>RL31_NICGU (P46290) 60S ribosomal protein L31| Length = 120 Score = 56.6 bits (135), Expect = 2e-08 Identities = 25/30 (83%), Positives = 30/30 (100%) Frame = -1 Query: 91 EEDAKEELYSLVTVAEVPAEGLKGLGTKVV 2 +EDAKEELYSLVTVAE+PA+GLKGLGTK++ Sbjct: 87 DEDAKEELYSLVTVAEIPAKGLKGLGTKII 116
>RL312_ARATH (P51420) 60S ribosomal protein L31-2| Length = 119 Score = 53.5 bits (127), Expect = 2e-07 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -1 Query: 91 EEDAKEELYSLVTVAEVPAEGLKGLGTKVV 2 +EDAKEE +SLVTVAE+PAEGL GLGTKV+ Sbjct: 86 DEDAKEEFFSLVTVAEIPAEGLSGLGTKVI 115
>RL31_PICMA (O65071) 60S ribosomal protein L31| Length = 120 Score = 53.5 bits (127), Expect = 2e-07 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -1 Query: 91 EEDAKEELYSLVTVAEVPAEGLKGLGTKVV 2 EEDAK+ELYS+VTVAEVP EGL GLGTK++ Sbjct: 87 EEDAKDELYSIVTVAEVPPEGLTGLGTKII 116
>RL311_ARATH (Q9STR1) 60S ribosomal protein L31-1| Length = 119 Score = 53.1 bits (126), Expect = 2e-07 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -1 Query: 91 EEDAKEELYSLVTVAEVPAEGLKGLGTKVV 2 +EDAKEE +SLVTVAE+PAEGL GLGTK++ Sbjct: 86 DEDAKEEFFSLVTVAEIPAEGLSGLGTKII 115
>RL31_PERFR (Q9M573) 60S ribosomal protein L31| Length = 121 Score = 52.4 bits (124), Expect = 4e-07 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -1 Query: 91 EEDAKEELYSLVTVAEVPAEGLKGLGTKVV 2 +EDAKEELYSLVTVAE+P GLKGLGT+V+ Sbjct: 88 DEDAKEELYSLVTVAEIPEGGLKGLGTQVI 117
>RL31_PANGI (Q9MAV7) 60S ribosomal protein L31| Length = 121 Score = 47.0 bits (110), Expect = 2e-05 Identities = 21/30 (70%), Positives = 27/30 (90%) Frame = -1 Query: 91 EEDAKEELYSLVTVAEVPAEGLKGLGTKVV 2 +EDAKEELYSLVTVA++PA LKGLG +++ Sbjct: 87 DEDAKEELYSLVTVAKIPAGTLKGLGPQII 116
>RL31_CHLRE (P45841) 60S ribosomal protein L31| Length = 116 Score = 35.0 bits (79), Expect = 0.060 Identities = 19/30 (63%), Positives = 22/30 (73%) Frame = -1 Query: 91 EEDAKEELYSLVTVAEVPAEGLKGLGTKVV 2 +EDAKEE+YS VTVAE + KG GT VV Sbjct: 86 DEDAKEEMYSFVTVAE--DQSTKGKGTVVV 113
>RL31_CYAPA (Q9XGL4) 60S ribosomal protein L31| Length = 119 Score = 31.2 bits (69), Expect = 0.86 Identities = 17/30 (56%), Positives = 21/30 (70%) Frame = -1 Query: 91 EEDAKEELYSLVTVAEVPAEGLKGLGTKVV 2 +EDAKE+LY+LVT VP KGL T+ V Sbjct: 89 DEDAKEKLYTLVTY--VPVTSFKGLQTQNV 116 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,484,187 Number of Sequences: 219361 Number of extensions: 115477 Number of successful extensions: 502 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 449 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 502 length of database: 80,573,946 effective HSP length: 6 effective length of database: 79,257,780 effective search space used: 1902186720 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)