| Clone Name | rbags8g13 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | IF2_EHRRW (Q5HB61) Translation initiation factor IF-2 | 29 | 7.1 | 2 | IF2_EHRRG (Q5FGX3) Translation initiation factor IF-2 | 29 | 7.1 | 3 | RT12_TRYBO (Q33569) Mitochondrial ribosomal protein S12 | 29 | 7.1 | 4 | STNB_CAEEL (P90761) Putative stoned B-like protein (Unc-41) | 28 | 9.2 |
|---|
>IF2_EHRRW (Q5HB61) Translation initiation factor IF-2| Length = 856 Score = 28.9 bits (63), Expect = 7.1 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +2 Query: 113 KKEHKXKRQRPKNIKVNNTNTKQRK 187 +KEH+ K+ PK + NNT TK K Sbjct: 213 EKEHEEKKGNPKKVMSNNTYTKHVK 237
>IF2_EHRRG (Q5FGX3) Translation initiation factor IF-2| Length = 856 Score = 28.9 bits (63), Expect = 7.1 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +2 Query: 113 KKEHKXKRQRPKNIKVNNTNTKQRK 187 +KEH+ K+ PK + NNT TK K Sbjct: 213 EKEHEEKKGNPKKVMSNNTYTKHVK 237
>RT12_TRYBO (Q33569) Mitochondrial ribosomal protein S12| Length = 87 Score = 28.9 bits (63), Expect = 7.1 Identities = 16/47 (34%), Positives = 20/47 (42%) Frame = -3 Query: 166 IIYFDIFWALPFXFVLFFCDCFIYAEXXXXXXXXXSL*YSTYEFRYV 26 ++ F FW L F+ F CFIY SL Y T F +V Sbjct: 41 LLLFYSFWLLRCFFIFFLVSCFIYVVEGGGFIDLPSLRYFTRLFYFV 87
>STNB_CAEEL (P90761) Putative stoned B-like protein (Unc-41)| Length = 1657 Score = 28.5 bits (62), Expect = 9.2 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = +2 Query: 266 RKITRLSAMSYNSGHT*TSRSLPPHIAATHKAVASNVAADH 388 RK + + + +SG S LPPH+AA ++A N DH Sbjct: 885 RKRSSIKDVQQDSGG---SLELPPHLAAPQDSIAPNPKGDH 922 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64,284,408 Number of Sequences: 219361 Number of extensions: 1323613 Number of successful extensions: 3261 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3199 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3260 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3130907202 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)