| Clone Name | rbags8f15 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CTX_PSEAE (P14608) Cytotoxin precursor (Leucocidin) | 31 | 1.4 | 2 | METE_CHLRE (Q39586) 5-methyltetrahydropteroyltriglutamate--homoc... | 29 | 5.2 | 3 | RADA_NANEQ (Q74MX9) DNA repair and recombination protein radA | 28 | 6.7 |
|---|
>CTX_PSEAE (P14608) Cytotoxin precursor (Leucocidin)| Length = 286 Score = 30.8 bits (68), Expect = 1.4 Identities = 16/61 (26%), Positives = 28/61 (45%) Frame = -2 Query: 363 TWDATXELKLGYNSTIRAGFPKLGLGAQISISAEXYGEYNWGQTMEKKVRHEVEYEAAVP 184 TW T +LK+G ++A P +G GA+I+ + E G + K + + + Sbjct: 96 TWSVTEQLKVGVEVKVKANIPLVG-GAEITSTVELSLSSTQGASTSKSSNYGASTKVLIS 154 Query: 183 P 181 P Sbjct: 155 P 155
>METE_CHLRE (Q39586) 5-methyltetrahydropteroyltriglutamate--homocysteine| methyltransferase (EC 2.1.1.14) (Methionine synthase, vitamin-B12 independent isozyme) (Cobalamin-independent methionine synthase) Length = 814 Score = 28.9 bits (63), Expect = 5.2 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = -2 Query: 324 STIRAGFPKLGLGAQISISAEXYGEYNWGQTMEKKVRHEVEYEA 193 ST GFP++G Q+ + E Y + + G+ V H+V+ +A Sbjct: 3 STTTIGFPRIGNQRQLKFAMESYFKGDSGEAELLAVAHKVQSDA 46
>RADA_NANEQ (Q74MX9) DNA repair and recombination protein radA| Length = 325 Score = 28.5 bits (62), Expect = 6.7 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = -2 Query: 297 LGLGAQISISAEXYGEYNWGQTMEKKVRHEVEYEAAVPP 181 LG G + + E YGEY G+T +V H++ + +PP Sbjct: 100 LGGGIETAALTEFYGEYGSGKT---QVGHQLAVDVQLPP 135 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,084,843 Number of Sequences: 219361 Number of extensions: 506689 Number of successful extensions: 1329 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1289 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1329 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)