| Clone Name | rbags8e11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | VE6_HPV66 (Q80955) Protein E6 | 32 | 1.1 | 2 | REPY_ECOLI (P22308) Replication initiation protein | 31 | 3.3 |
|---|
>VE6_HPV66 (Q80955) Protein E6| Length = 155 Score = 32.3 bits (72), Expect = 1.1 Identities = 14/36 (38%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = +2 Query: 254 LHLKVDCTLCRKPITR-GLHRYNQFSISLIYRNNTP 358 L L++ C C+K +T L+R+ + L+YRNN P Sbjct: 27 LDLRLSCVYCKKELTSLELYRFACIELKLVYRNNWP 62
>REPY_ECOLI (P22308) Replication initiation protein| Length = 316 Score = 30.8 bits (68), Expect = 3.3 Identities = 20/85 (23%), Positives = 40/85 (47%) Frame = +2 Query: 152 WLFKDILQKKRRPTNCNLHLAENKITHVSTSS*CLHLKVDCTLCRKPITRGLHRYNQFSI 331 WL K++ QKK N + L E K + ++ +++ + KPI++ L+ Y+ + Sbjct: 148 WLLKELTQKKTHKANIEISLDEFKFMLMLENNYHEFKRLNQWVL-KPISKDLNTYSNMKL 206 Query: 332 SLIYRNNTPNKLNHTIRLGRQFSIL 406 + R + L + L RQ ++ Sbjct: 207 VVDKRGRPTDTLIFQVELDRQMDLV 231 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 84,306,978 Number of Sequences: 219361 Number of extensions: 1678946 Number of successful extensions: 4031 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3905 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4023 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5596027262 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)