| Clone Name | rbags8c02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | LYOX_BOVIN (P33072) Protein-lysine 6-oxidase precursor (EC 1.4.3... | 28 | 4.7 | 2 | LYOX_RAT (P16636) Protein-lysine 6-oxidase precursor (EC 1.4.3.1... | 28 | 4.7 | 3 | CDH_PHACH (Q01738) Cellobiose dehydrogenase precursor (EC 1.1.99... | 28 | 8.0 |
|---|
>LYOX_BOVIN (P33072) Protein-lysine 6-oxidase precursor (EC 1.4.3.13) (Lysyl| oxidase) Length = 418 Score = 28.5 bits (62), Expect = 4.7 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = -3 Query: 179 SWSWVGMAQRVHKLNEGGNYXLLRHSTQ 96 SW W Q H ++E +Y LL STQ Sbjct: 286 SWEWHSCHQHYHSMDEFSHYDLLDASTQ 313
>LYOX_RAT (P16636) Protein-lysine 6-oxidase precursor (EC 1.4.3.13) (Lysyl| oxidase) Length = 411 Score = 28.5 bits (62), Expect = 4.7 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = -3 Query: 179 SWSWVGMAQRVHKLNEGGNYXLLRHSTQ 96 SW W Q H ++E +Y LL STQ Sbjct: 279 SWEWHSCHQHYHSMDEFSHYDLLDASTQ 306
>CDH_PHACH (Q01738) Cellobiose dehydrogenase precursor (EC 1.1.99.18) (CDH)| (Cellobiose-quinone oxidoreductase) Length = 773 Score = 27.7 bits (60), Expect = 8.0 Identities = 11/35 (31%), Positives = 14/35 (40%) Frame = -3 Query: 185 ATSWSWVGMAQRVHKLNEGGNYXLLRHSTQTWCFS 81 +T W WV Q + N GG + W FS Sbjct: 130 STHWKWVFRCQGCTEWNNGGGIDVTSQGVLAWAFS 164 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,206,962 Number of Sequences: 219361 Number of extensions: 669832 Number of successful extensions: 1622 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1593 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1622 length of database: 80,573,946 effective HSP length: 64 effective length of database: 66,534,842 effective search space used: 1596836208 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)