| Clone Name | rbags7k24 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FOXGB_RAT (Q00939) Forkhead box protein G1B (Forkhead-related pr... | 32 | 2.4 | 2 | PI2R_BOVIN (P79393) Prostacyclin receptor (Prostanoid IP recepto... | 31 | 4.1 | 3 | FTSK_CORGL (Q8NP53) DNA translocase ftsK | 30 | 5.3 | 4 | MUC2_RAT (Q62635) Mucin-2 precursor (Intestinal mucin 2) (Fragment) | 30 | 6.9 | 5 | FOXGB_MOUSE (Q60987) Forkhead box protein G1B (Forkhead-related ... | 30 | 6.9 |
|---|
>FOXGB_RAT (Q00939) Forkhead box protein G1B (Forkhead-related protein FKHL1)| (Transcription factor BF-1) (Brain factor 1) (BF1) Length = 480 Score = 31.6 bits (70), Expect = 2.4 Identities = 20/53 (37%), Positives = 25/53 (47%) Frame = +1 Query: 169 PMPALSSLTVSAHADGGAAVWSATGGIPGFGVADVVELAEDGREEGEGCTGSE 327 P P L L SA DG A G PG G A++ + D +E+G G G E Sbjct: 96 PQPLL--LPPSAALDGAKADALGAKGEPGGGPAELAPVGPDEKEKGAGAGGEE 146
>PI2R_BOVIN (P79393) Prostacyclin receptor (Prostanoid IP receptor) (PGI| receptor) (Prostaglandin I2 receptor) Length = 385 Score = 30.8 bits (68), Expect = 4.1 Identities = 21/51 (41%), Positives = 25/51 (49%) Frame = -3 Query: 531 SRCFCCGRGLKPGGSRACALMLFLFSWLTFLVAAACLLAGSVRNAYHTRYR 379 S CF R +PGG CA +L S + LVAA L GSV + YR Sbjct: 168 SWCFIRMRSAEPGG---CAFLLAYASLVALLVAAIVLCNGSVTLSLCRMYR 215
>FTSK_CORGL (Q8NP53) DNA translocase ftsK| Length = 921 Score = 30.4 bits (67), Expect = 5.3 Identities = 19/46 (41%), Positives = 22/46 (47%), Gaps = 12/46 (26%) Frame = +1 Query: 184 SSLTVSAHADG------------GAAVWSATGGIPGFGVADVVELA 285 +S V HADG GAAVW GG G +AD+V LA Sbjct: 59 TSAYVEEHADGIALSLVGIAIVLGAAVWLGIGGPIGTFIADIVHLA 104
>MUC2_RAT (Q62635) Mucin-2 precursor (Intestinal mucin 2) (Fragment)| Length = 1513 Score = 30.0 bits (66), Expect = 6.9 Identities = 21/96 (21%), Positives = 38/96 (39%) Frame = +2 Query: 329 TPLRSVSQESGSPLKIPLYRVWYALRTDPASKHAAATRKVSHEKRKSMRAQAREPPGLSP 508 TP+ S Q + SP +P + T P + H +T + S + P + Sbjct: 1397 TPISSTPQPTSSPTTLPTTSPLTSSATSPTTSHITSTVSPTTSPTTSTTSPTTSPTTSTT 1456 Query: 509 RPQQKHRLASMTTTCAAVRRRSAPTP*PVATSES*T 616 P ++ + T + ++PTP P ++ S T Sbjct: 1457 SP----TTSTTSPTPSPTTSTTSPTPSPTTSTTSPT 1488
>FOXGB_MOUSE (Q60987) Forkhead box protein G1B (Forkhead-related protein FKHL1)| (Transcription factor BF-1) (Brain factor 1) (BF1) Length = 481 Score = 30.0 bits (66), Expect = 6.9 Identities = 19/53 (35%), Positives = 24/53 (45%) Frame = +1 Query: 169 PMPALSSLTVSAHADGGAAVWSATGGIPGFGVADVVELAEDGREEGEGCTGSE 327 P P L L S DG A G PG G A++ + D +E+G G G E Sbjct: 97 PQPLL--LPPSTALDGAKADALGAKGEPGGGPAELAPVGPDEKEKGAGAGGEE 147 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 79,678,113 Number of Sequences: 219361 Number of extensions: 1440646 Number of successful extensions: 5772 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5508 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5765 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6825954960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)