ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbags7j04 |
|---|---|
| Clone Library Name | barley_pub |
>UGDH_SOYBN (Q96558) UDP-glucose 6-dehydrogenase (EC 1.1.1.22) (UDP-Glc| dehydrogenase) (UDP-GlcDH) (UDPGDH) Length = 480 Score = 131 bits (329), Expect(2) = 2e-34 Identities = 59/70 (84%), Positives = 66/70 (94%) Frame = -1 Query: 437 RGAHAVCILTEWNEFKELDYQKIFNNMQKPAFVFDGRNVVNADKLREIGFIVYSIGKPLD 258 + AH +CILTEW+EFK LDYQKIF+NMQKPAFVFDGRN+V+ADKLREIGFIVYSIGKPLD Sbjct: 411 KDAHGLCILTEWDEFKTLDYQKIFDNMQKPAFVFDGRNIVDADKLREIGFIVYSIGKPLD 470 Query: 257 AWLKDMPAIA 228 WLKDMPA+A Sbjct: 471 PWLKDMPAVA 480 Score = 33.5 bits (75), Expect(2) = 2e-34 Identities = 14/17 (82%), Positives = 17/17 (100%) Frame = -3 Query: 486 SSVKQVSVVWDAYEATK 436 ++VK+VSVVWDAYEATK Sbjct: 395 TTVKKVSVVWDAYEATK 411
>UGDH_CAEEL (Q19905) UDP-glucose 6-dehydrogenase (EC 1.1.1.22) (UDP-Glc| dehydrogenase) (UDP-GlcDH) (UDPGDH) (Squashed vulva protein 4) Length = 481 Score = 73.9 bits (180), Expect = 2e-13 Identities = 33/60 (55%), Positives = 45/60 (75%) Frame = -1 Query: 437 RGAHAVCILTEWNEFKELDYQKIFNNMQKPAFVFDGRNVVNADKLREIGFIVYSIGKPLD 258 RGAHA+ +LTEW+EF EL+Y +I N+MQ PA +FDGR +++ LREIGF ++IG D Sbjct: 411 RGAHAIVVLTEWDEFVELNYSQIHNDMQHPAAIFDGRLILDQKALREIGFRTFAIGTSPD 470
>UGDH_DROME (O02373) UDP-glucose 6-dehydrogenase (EC 1.1.1.22) (UDP-Glc| dehydrogenase) (UDP-GlcDH) (UDPGDH) (Protein sugarless) Length = 476 Score = 71.2 bits (173), Expect = 1e-12 Identities = 28/57 (49%), Positives = 46/57 (80%) Frame = -1 Query: 437 RGAHAVCILTEWNEFKELDYQKIFNNMQKPAFVFDGRNVVNADKLREIGFIVYSIGK 267 R HA+ I TEW+EF +LD+++I+ +M KPA++FDGR +++ ++L++IGF V +IGK Sbjct: 403 RATHALVICTEWDEFVDLDFKRIYQSMMKPAYIFDGRKILDHERLQQIGFHVQTIGK 459
>UGDH_HUMAN (O60701) UDP-glucose 6-dehydrogenase (EC 1.1.1.22) (UDP-Glc| dehydrogenase) (UDP-GlcDH) (UDPGDH) Length = 494 Score = 69.7 bits (169), Expect = 4e-12 Identities = 33/62 (53%), Positives = 46/62 (74%), Gaps = 2/62 (3%) Frame = -1 Query: 434 GAHAVCILTEWNEFKELDYQKIFNNMQKPAFVFDGRNVVNA--DKLREIGFIVYSIGKPL 261 GAHAV I TEW+ FKELDY++I M KPAF+FDGR V++ ++L+ IGF + +IGK + Sbjct: 407 GAHAVVICTEWDMFKELDYERIHKKMLKPAFIFDGRRVLDGLHNELQTIGFQIETIGKKV 466 Query: 260 DA 255 + Sbjct: 467 SS 468
>UGDH_BOVIN (P12378) UDP-glucose 6-dehydrogenase (EC 1.1.1.22) (UDP-Glc| dehydrogenase) (UDP-GlcDH) (UDPGDH) Length = 494 Score = 69.7 bits (169), Expect = 4e-12 Identities = 33/62 (53%), Positives = 46/62 (74%), Gaps = 2/62 (3%) Frame = -1 Query: 434 GAHAVCILTEWNEFKELDYQKIFNNMQKPAFVFDGRNVVNA--DKLREIGFIVYSIGKPL 261 GAHAV I TEW+ FKELDY++I M KPAF+FDGR V++ ++L+ IGF + +IGK + Sbjct: 407 GAHAVVICTEWDMFKELDYERIHKKMLKPAFIFDGRRVLDGLHNELQTIGFQIETIGKKV 466 Query: 260 DA 255 + Sbjct: 467 SS 468
>UGDH_RAT (O70199) UDP-glucose 6-dehydrogenase (EC 1.1.1.22) (UDP-Glc| dehydrogenase) (UDP-GlcDH) (UDPGDH) Length = 493 Score = 68.6 bits (166), Expect = 9e-12 Identities = 32/62 (51%), Positives = 46/62 (74%), Gaps = 2/62 (3%) Frame = -1 Query: 434 GAHAVCILTEWNEFKELDYQKIFNNMQKPAFVFDGRNVVNA--DKLREIGFIVYSIGKPL 261 GAHA+ I TEW+ FKELDY++I M KPAF+FDGR V++ ++L+ IGF + +IGK + Sbjct: 407 GAHALVICTEWDMFKELDYERIHKRMLKPAFIFDGRRVLDGLHNELQTIGFQIETIGKKV 466 Query: 260 DA 255 + Sbjct: 467 SS 468
>UGDH_MOUSE (O70475) UDP-glucose 6-dehydrogenase (EC 1.1.1.22) (UDP-Glc| dehydrogenase) (UDP-GlcDH) (UDPGDH) Length = 493 Score = 68.2 bits (165), Expect = 1e-11 Identities = 32/62 (51%), Positives = 45/62 (72%), Gaps = 2/62 (3%) Frame = -1 Query: 434 GAHAVCILTEWNEFKELDYQKIFNNMQKPAFVFDGRNVVNA--DKLREIGFIVYSIGKPL 261 GAHA+ I TEW+ FKELDY++I M KPAF+FDGR V++ +L+ IGF + +IGK + Sbjct: 407 GAHALVICTEWDMFKELDYERIHKKMLKPAFIFDGRRVLDGLHSELQTIGFQIETIGKKV 466 Query: 260 DA 255 + Sbjct: 467 SS 468
>UDG_PSEAE (O86422) UDP-glucose 6-dehydrogenase (EC 1.1.1.22) (UDP-Glc| dehydrogenase) (UDP-GlcDH) (UDPGDH) Length = 453 Score = 55.1 bits (131), Expect = 1e-07 Identities = 25/57 (43%), Positives = 39/57 (68%) Frame = -1 Query: 434 GAHAVCILTEWNEFKELDYQKIFNNMQKPAFVFDGRNVVNADKLREIGFIVYSIGKP 264 GA A+ ++TEW +F++ D+QKI +M+ P V DGRN+ ++ E+GFI IG+P Sbjct: 388 GADALVLVTEWKQFRQPDFQKIRGSMRTPLLV-DGRNLYAPARMAELGFIYQGIGRP 443
>UDG_RICPR (O05973) UDP-glucose 6-dehydrogenase (EC 1.1.1.22) (UDP-Glc| dehydrogenase) (UDP-GlcDH) (UDPGDH) Length = 434 Score = 51.6 bits (122), Expect = 1e-06 Identities = 21/54 (38%), Positives = 40/54 (74%) Frame = -1 Query: 422 VCILTEWNEFKELDYQKIFNNMQKPAFVFDGRNVVNADKLREIGFIVYSIGKPL 261 + I TEW+EFKEL++Q+I+N ++ P + D RN+++ + +++IGF Y++G + Sbjct: 382 IVIATEWSEFKELNWQEIYNLVKSP-MIIDLRNILDNEVMKKIGFRYYAVGSQI 434
>UDG_RICCN (Q92GB1) UDP-glucose 6-dehydrogenase (EC 1.1.1.22) (UDP-Glc| dehydrogenase) (UDP-GlcDH) (UDPGDH) Length = 432 Score = 50.4 bits (119), Expect = 2e-06 Identities = 20/54 (37%), Positives = 40/54 (74%) Frame = -1 Query: 422 VCILTEWNEFKELDYQKIFNNMQKPAFVFDGRNVVNADKLREIGFIVYSIGKPL 261 + I TEW+EFKEL++Q+I++ ++ P + D RN+++ + +++IGF Y++G + Sbjct: 380 IVIATEWSEFKELNWQEIYDLVKSP-IIIDFRNILDNETMKKIGFRYYAVGSKI 432
>UDG_RHIME (O54068) UDP-glucose 6-dehydrogenase (EC 1.1.1.22) (UDP-Glc| dehydrogenase) (UDP-GlcDH) (UDPGDH) Length = 437 Score = 50.1 bits (118), Expect = 3e-06 Identities = 24/56 (42%), Positives = 37/56 (66%) Frame = -1 Query: 431 AHAVCILTEWNEFKELDYQKIFNNMQKPAFVFDGRNVVNADKLREIGFIVYSIGKP 264 A A+ I+TEWNEF+ LD+ ++ + M+ P V D RN+ D++ + GF SIG+P Sbjct: 382 ADALVIITEWNEFRALDFDRLKSTMKTPLLV-DLRNIYRKDEVAKHGFRYASIGRP 436
>TUAD_BACSU (O32271) UDP-glucose 6-dehydrogenase (EC 1.1.1.22) (UDP-Glc| dehydrogenase) (UDP-GlcDH) (UDPGDH) (Teichuronic acid biosynthesis protein tuaD) Length = 461 Score = 46.6 bits (109), Expect = 4e-05 Identities = 20/54 (37%), Positives = 37/54 (68%) Frame = -1 Query: 425 AVCILTEWNEFKELDYQKIFNNMQKPAFVFDGRNVVNADKLREIGFIVYSIGKP 264 A ILT+W E KE++ K+ +++P + DGRN+ + ++++ G+I +SIG+P Sbjct: 380 ACLILTDWPEVKEMELVKVKTLLKQPVII-DGRNLFSLEEMQAAGYIYHSIGRP 432
>Y1054_METJA (Q58454) Hypothetical protein MJ1054 (EC 1.1.1.-) [Contains: Mja| UDPGD intein] Length = 895 Score = 44.3 bits (103), Expect = 2e-04 Identities = 19/50 (38%), Positives = 35/50 (70%) Frame = -1 Query: 416 ILTEWNEFKELDYQKIFNNMQKPAFVFDGRNVVNADKLREIGFIVYSIGK 267 I+T +F + D++KI N+ K VFDGRN+++ +K++++GF Y +G+ Sbjct: 847 IITVEYDFNKEDWEKI-GNLVKEKVVFDGRNILDVEKIKKLGFKYYGVGR 895
>YKD8_YEAST (P32862) Putative 128.2 kDa transcriptional regulatory protein in| PTM1-IXR1 intergenic region Length = 1170 Score = 29.6 bits (65), Expect = 4.5 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +2 Query: 62 KTAQGLRNMYDLQTAVQERRTRSKDTNTTQFYA*LKMPRLRK-SL*NFLQLLWR 220 K+ QGLR ++T + ERRT T A + PRL +L NF+ + W+ Sbjct: 1109 KSGQGLRESSVMKTLLDERRTSGTQPTTAPVAA--EEPRLENVALENFVSIGWK 1160
>CBP2_HORVU (P08818) Serine carboxypeptidase 2 precursor (EC 3.4.16.6) (Serine| carboxypeptidase II) (Carboxypeptidase D) (CP-MII) [Contains: Serine carboxypeptidase 2 chain A (Serine carboxypeptidase II chain A); Serine carboxypeptidase 2 chain B (Serine Length = 476 Score = 28.9 bits (63), Expect = 7.7 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = -3 Query: 291 LHCLLHRQAARCVAQGHARDRLVPL 217 L CLL R AA A GHA DR+V L Sbjct: 22 LTCLLLRPAAVAAAGGHAADRIVRL 46 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,539,579 Number of Sequences: 219361 Number of extensions: 1204579 Number of successful extensions: 3660 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 3570 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3655 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3420806017 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
