| Clone Name | rbags7g20 |
|---|---|
| Clone Library Name | barley_pub |
>ATP5E_MAIZE (Q41898) ATP synthase epsilon chain, mitochondrial (EC 3.6.3.14)| Length = 70 Score = 90.5 bits (223), Expect(2) = 4e-22 Identities = 39/50 (78%), Positives = 47/50 (94%) Frame = -1 Query: 407 GYSNVCAALVRSCLKEPFKTELSSREKVHFSLSKWTDEKQQKPTVRTDEE 258 GYSN+CAALVR+CLKEPFK+E +SREKVHFS+SKWTD KQ+KPTVRT+ + Sbjct: 20 GYSNICAALVRNCLKEPFKSEAASREKVHFSISKWTDGKQEKPTVRTESD 69 Score = 33.1 bits (74), Expect(2) = 4e-22 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 444 VPFWRAAGMTYIG 406 VPFWRAAGMTYIG Sbjct: 8 VPFWRAAGMTYIG 20
>ATP5E_IPOBA (Q06450) ATP synthase epsilon chain, mitochondrial (EC 3.6.3.14)| Length = 69 Score = 73.6 bits (179), Expect(2) = 2e-16 Identities = 31/47 (65%), Positives = 38/47 (80%) Frame = -1 Query: 404 YSNVCAALVRSCLKEPFKTELSSREKVHFSLSKWTDEKQQKPTVRTD 264 YSN+CA +VR+CLKEP++ E SREKVHFS SKW D K QKP +R+D Sbjct: 19 YSNLCANMVRNCLKEPYRAEALSREKVHFSFSKWVDGKPQKPAIRSD 65 Score = 30.8 bits (68), Expect(2) = 2e-16 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 444 VPFWRAAGMTYI 409 VPFWRAAGMTYI Sbjct: 6 VPFWRAAGMTYI 17
>ATP5E_ARATH (Q96253) ATP synthase epsilon chain, mitochondrial (EC 3.6.3.14)| Length = 69 Score = 73.6 bits (179), Expect(2) = 2e-16 Identities = 32/47 (68%), Positives = 38/47 (80%) Frame = -1 Query: 404 YSNVCAALVRSCLKEPFKTELSSREKVHFSLSKWTDEKQQKPTVRTD 264 YSN+CA +VR+CLKEP K E +REKVHFSLSKW D K QKP +R+D Sbjct: 19 YSNICANIVRNCLKEPHKAEALTREKVHFSLSKWADGKPQKPVLRSD 65 Score = 30.8 bits (68), Expect(2) = 2e-16 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 444 VPFWRAAGMTYI 409 VPFWRAAGMTYI Sbjct: 6 VPFWRAAGMTYI 17
>ATP5E_SCHPO (P87316) Putative ATP synthase epsilon chain, mitochondrial (EC| 3.6.3.14) Length = 67 Score = 32.7 bits (73), Expect = 0.56 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = -1 Query: 410 SGYSNVCAALVRSCLKEPFKTELSSREKVHFSLSKWTDEKQQK 282 S Y+++C+ VR LK K E+ + F ++W + Q+K Sbjct: 12 SKYASICSQTVRQALKPEIKNEVKTHGDAEFLYTRWKNGAQEK 54
>MARK4_MOUSE (Q8CIP4) MAP/microtubule affinity-regulating kinase 4 (EC 2.7.11.1)| Length = 752 Score = 30.4 bits (67), Expect = 2.8 Identities = 17/40 (42%), Positives = 23/40 (57%) Frame = +3 Query: 105 VSHGSSSRKGAISKYNNIVSE*IHCHRTNLFLRPDHKSTN 224 VSHG K A +K+ IVS +CH+ N+ R D K+ N Sbjct: 148 VSHGRMKEKEARAKFRQIVSAVHYCHQKNIVHR-DLKAEN 186
>MARK4_HUMAN (Q96L34) MAP/microtubule affinity-regulating kinase 4 (EC 2.7.11.1)| (MAP/microtubule affinity-regulating kinase-like 1) Length = 752 Score = 30.4 bits (67), Expect = 2.8 Identities = 17/40 (42%), Positives = 23/40 (57%) Frame = +3 Query: 105 VSHGSSSRKGAISKYNNIVSE*IHCHRTNLFLRPDHKSTN 224 VSHG K A +K+ IVS +CH+ N+ R D K+ N Sbjct: 148 VSHGRMKEKEARAKFRQIVSAVHYCHQKNIVHR-DLKAEN 186
>SYN_RHOBA (Q7UHE1) Asparaginyl-tRNA synthetase (EC 6.1.1.22)| (Asparagine--tRNA ligase) (AsnRS) Length = 490 Score = 28.9 bits (63), Expect = 8.1 Identities = 15/58 (25%), Positives = 34/58 (58%), Gaps = 8/58 (13%) Frame = +1 Query: 250 DLHSSSVRTVGFCCFSSVHLEREK--------WTFSREESSVLKGSLRQLRTSAAQTL 399 +LH+SSVR +G+C + L++++ W+ R ++ L G++ ++R +Q++ Sbjct: 118 ELHASSVRVIGWCDGETYPLQKKRHSFEKLREWSHLRARTNTL-GAVMRVRNRISQSI 174 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,147,035 Number of Sequences: 219361 Number of extensions: 787342 Number of successful extensions: 2043 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2015 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2043 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3581144924 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)