| Clone Name | rbags7g10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TBX5_HUMAN (Q99593) T-box transcription factor TBX5 (T-box prote... | 33 | 1.1 | 2 | CYTSA_XENTR (Q2KN96) Cytospin-A | 30 | 5.3 | 3 | ZC3H6_HUMAN (P61129) Zinc finger CCCH-type domain-containing pro... | 30 | 6.9 | 4 | COX2_PAPHA (P68298) Cytochrome c oxidase subunit 2 (EC 1.9.3.1) ... | 30 | 9.1 | 5 | COX2_PAPAN (P68297) Cytochrome c oxidase subunit 2 (EC 1.9.3.1) ... | 30 | 9.1 |
|---|
>TBX5_HUMAN (Q99593) T-box transcription factor TBX5 (T-box protein 5)| Length = 518 Score = 32.7 bits (73), Expect = 1.1 Identities = 15/40 (37%), Positives = 23/40 (57%) Frame = -3 Query: 133 FQSESGISAPSLEVLLSTNVYRLPVLHITLYVCLFVRREK 14 +Q E+G+S PS ++L N Y LP H +Y C + E+ Sbjct: 291 YQCENGVSGPSQDLLPPPNPYPLPQEHSQIYHCTKRKEEE 330
>CYTSA_XENTR (Q2KN96) Cytospin-A| Length = 1101 Score = 30.4 bits (67), Expect = 5.3 Identities = 22/67 (32%), Positives = 38/67 (56%), Gaps = 2/67 (2%) Frame = -1 Query: 672 RDPMI*TSPSITVSQLKGTQTVKRTVTNVAD--EAETYTIMTRMSPEIALDVSPPALTVL 499 R P I + SI+VS+ + ++ +KR ++ V D A + +MT SP+++L S P +V Sbjct: 914 RVPAIDNAKSISVSR-RSSEELKRDIS-VPDGSSAPSLMVMTSPSPQLSLSSSSPTASVT 971 Query: 498 PGSSREI 478 P + I Sbjct: 972 PTARSRI 978
>ZC3H6_HUMAN (P61129) Zinc finger CCCH-type domain-containing protein 6| Length = 1189 Score = 30.0 bits (66), Expect = 6.9 Identities = 25/97 (25%), Positives = 43/97 (44%), Gaps = 8/97 (8%) Frame = +2 Query: 170 PGEIYLPCHINRLQNPTYFYILGH-HHNTDNTSLPN------YVGSYCSYQTTKYYNTPQ 328 PGE+ L + LQNP FY + H+ N PN + G + Q ++P Sbjct: 579 PGEMQLNTNYESLQNPAEFYDNYYAQHSIHNFQPPNNSGDGMWHGEFAQQQPPVVQDSPN 638 Query: 329 L-RAS*ENNTRPYLNPMATTGILTRWRRSPFIVISPK 436 S ++TR P+ G+L +R+ F+ ++ + Sbjct: 639 HGSGSDGSSTRTGHGPLPVPGLLPAVQRALFVRLTQR 675
>COX2_PAPHA (P68298) Cytochrome c oxidase subunit 2 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide II) Length = 227 Score = 29.6 bits (65), Expect = 9.1 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = -1 Query: 627 LKGTQTVKRTVTNVADEAETYTIMTRMSPEIALDVSPPALTVL 499 L T T K T TN+ D E TI T + I + ++ P+L +L Sbjct: 42 LSSTLTTKLTNTNITDAQEMETIWTILPAVILILIALPSLRIL 84
>COX2_PAPAN (P68297) Cytochrome c oxidase subunit 2 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide II) Length = 227 Score = 29.6 bits (65), Expect = 9.1 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = -1 Query: 627 LKGTQTVKRTVTNVADEAETYTIMTRMSPEIALDVSPPALTVL 499 L T T K T TN+ D E TI T + I + ++ P+L +L Sbjct: 42 LSSTLTTKLTNTNITDAQEMETIWTILPAVILILIALPSLRIL 84 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 103,400,772 Number of Sequences: 219361 Number of extensions: 2246266 Number of successful extensions: 5411 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5216 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5407 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 6856295237 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)