| Clone Name | rbags7f24 |
|---|---|
| Clone Library Name | barley_pub |
>MEF2C_HUMAN (Q06413) Myocyte-specific enhancer factor 2C| Length = 473 Score = 30.4 bits (67), Expect = 4.9 Identities = 20/66 (30%), Positives = 29/66 (43%) Frame = +3 Query: 273 LRIFPCYYLLRLHPCFLLQLYQNLRVLSPYAPQLNLQATPNALPSDLSVLPSPY*FQPEQ 452 L P L +L C L Q+ + P LN+++ P + P D + PS Y Sbjct: 355 LHNMPPSALSQLGACTSTHLSQSSNLSLPSTQSLNIKSEPVSPPRDRTTTPSRY-----P 409 Query: 453 QHRRHQ 470 QH RH+ Sbjct: 410 QHTRHE 415
>SYM_LACLA (Q9CHE0) Methionyl-tRNA synthetase (EC 6.1.1.10) (Methionine--tRNA| ligase) (MetRS) Length = 662 Score = 30.4 bits (67), Expect = 4.9 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 3/57 (5%) Frame = +3 Query: 105 EIYKEEKNTLLEGLAPVSHE---VPQKPYLFRIWYFSLLDLQAYPF*AFC*ENHPAF 266 EI+++E + G+AP HE V ++ Y FR+ ++ LQ Y + HP F Sbjct: 143 EIFRDESGNITGGIAPSGHEVEWVEEETYFFRMGKYADWLLQYY-------DEHPDF 192
>ERG28_ARATH (O80594) Probable ergosterol biosynthetic protein 28| Length = 110 Score = 30.4 bits (67), Expect = 4.9 Identities = 25/87 (28%), Positives = 35/87 (40%), Gaps = 1/87 (1%) Frame = +1 Query: 193 FGIFPYWTYKLILFELFVKRXXXXXXXXXXXXVIIFCVCILAF-CFSSIRI*ECFLHTLL 369 FG F W +L +F + V C L F C ++ +L T L Sbjct: 21 FGFFNIWALRLAVFS----QTTMSEVHGRTFGVWTLLTCTLCFLCAFNLENKPLYLATFL 76 Query: 370 N*IFKQPPMHFLLIYLFCQVLTSSNQS 450 + I+ HFL YLF Q +T +N S Sbjct: 77 SFIYALG--HFLTEYLFYQTMTIANLS 101
>SYM_ENTFA (Q837B3) Methionyl-tRNA synthetase (EC 6.1.1.10) (Methionine--tRNA| ligase) (MetRS) Length = 669 Score = 30.0 bits (66), Expect = 6.5 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 3/57 (5%) Frame = +3 Query: 105 EIYKEEKNTLLEGLAPVSHE---VPQKPYLFRIWYFSLLDLQAYPF*AFC*ENHPAF 266 E+Y++++ ++ G AP HE V ++ Y FR+ ++ +Q Y E HP F Sbjct: 143 EVYRDDEGNVIGGKAPSGHEVELVKEESYFFRMSKYADRLVQYY-------EEHPEF 192
>RBPMS_MOUSE (Q9WVB0) RNA-binding protein with multiple splicing (RBP-MS)| (HEart, RRM Expressed Sequence) (Hermes) Length = 197 Score = 29.6 bits (65), Expect = 8.4 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = -3 Query: 246 NKKLKKDKLVGPIGKNTKSETSMVSAAPRVKLELTLPATY 127 N K+ K+KLVG +T ++ + R ELT+PA Y Sbjct: 102 NTKMAKNKLVGTPNPSTPLPNTVPHSVAREPYELTVPALY 141 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 85,002,502 Number of Sequences: 219361 Number of extensions: 1574395 Number of successful extensions: 4298 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4139 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4291 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6370891296 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)