| Clone Name | rbags7d22 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SC24A_HUMAN (O95486) Protein transport protein Sec24A (SEC24-rel... | 31 | 2.8 | 2 | POLG_HCVEU (O39927) Genome polyprotein [Contains: Core protein p... | 31 | 2.8 | 3 | POLG_HCV6A (Q5I2N3) Genome polyprotein [Contains: Core protein p... | 31 | 3.6 | 4 | MURB_AGRT5 (Q8UDN0) UDP-N-acetylenolpyruvoylglucosamine reductas... | 30 | 6.2 |
|---|
>SC24A_HUMAN (O95486) Protein transport protein Sec24A (SEC24-related protein A)| (Fragment) Length = 1078 Score = 31.2 bits (69), Expect = 2.8 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 4/41 (9%) Frame = -1 Query: 610 STPQRFWLPLLHDSVKLLNCKPH----PLLNVAETTLLLNK 500 STP + +P LH+ ++ LNC P L ++ +T LLNK Sbjct: 347 STPLKPPVPNLHEDIQKLNCNPELFRCTLTSIPQTQALLNK 387
>POLG_HCVEU (O39927) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3017 Score = 31.2 bits (69), Expect = 2.8 Identities = 27/80 (33%), Positives = 35/80 (43%), Gaps = 10/80 (12%) Frame = -1 Query: 592 WLPLLH-----DSVKLLNCKPHPLLNVAETTLLLNKLQEL-----SMAKLRPDFCSNHLP 443 W+P L DS+ LL C HP L T +LL L L S+ K+ P F H+ Sbjct: 863 WVPDLRVRGGRDSIILLTCLLHPQLGFEVTKILLAVLAPLYILQYSLLKV-PYFVRAHIL 921 Query: 442 IHALSSVRLALGSNLARAIL 383 + A VR G +A L Sbjct: 922 LRACLLVRRLAGGKYVQACL 941
>POLG_HCV6A (Q5I2N3) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3018 Score = 30.8 bits (68), Expect = 3.6 Identities = 27/80 (33%), Positives = 35/80 (43%), Gaps = 10/80 (12%) Frame = -1 Query: 592 WLPLLH-----DSVKLLNCKPHPLLNVAETTLLLNKLQEL-----SMAKLRPDFCSNHLP 443 W+P L DS+ LL C HP L T +LL L L S+ K+ P F H+ Sbjct: 864 WVPDLRVRGGRDSIILLTCLLHPQLGFEVTKILLAILAPLYILQYSLLKV-PYFVRAHIL 922 Query: 442 IHALSSVRLALGSNLARAIL 383 + A VR G +A L Sbjct: 923 LRACLLVRRLAGGRYVQACL 942
>MURB_AGRT5 (Q8UDN0) UDP-N-acetylenolpyruvoylglucosamine reductase (EC| 1.1.1.158) (UDP-N-acetylmuramate dehydrogenase) Length = 321 Score = 30.0 bits (66), Expect = 6.2 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 4/40 (10%) Frame = +1 Query: 331 RHQTGA----NPPPDTAFKLLQEWHGRGLIPGPT*QSSVH 438 R QTG NP +A++L+ E GRGL+ G SS+H Sbjct: 226 REQTGGSTFKNPEGHSAWELIDEAGGRGLVIGGAQMSSLH 265 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 91,516,305 Number of Sequences: 219361 Number of extensions: 1819021 Number of successful extensions: 4138 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3976 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4137 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6143359464 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)