ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbags6o12 |
|---|---|
| Clone Library Name | barley_pub |
>SFR16_HUMAN (Q8N2M8) Splicing factor, arginine/serine-rich 16 (Suppressor of| white-apricot homolog 2) Length = 659 Score = 36.6 bits (83), Expect = 0.089 Identities = 22/48 (45%), Positives = 32/48 (66%) Frame = -3 Query: 476 LNPSQSRCQNPNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPS 333 L+PS+SR +RS SP+PS Q+ + S+SR QS S SP+R + P+ Sbjct: 485 LSPSRSRSLTRSRSHSPSPS--QSRSRSRSRSQSPSPSPAREKLTRPA 530
>H6ST2_MOUSE (Q80UW0) Heparan-sulfate 6-O-sulfotransferase 2 (EC 2.8.2.-)| (HS6ST-2) (mHS6ST-2) (Fragment) Length = 538 Score = 36.6 bits (83), Expect = 0.089 Identities = 18/51 (35%), Positives = 33/51 (64%) Frame = -3 Query: 464 QSRCQNPNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPSLTQCQNQ 312 QS+ Q ++SQSP + QN NP+ ++ +++LS + S +P+ TQ +N+ Sbjct: 457 QSQSQGQSQSQSPGQNLSQNPNPNPNQNLTQNLSHNLTPSSNPNSTQRENR 507
>CWC21_USTMA (Q4P0G6) Pre-mRNA-splicing factor CWC21| Length = 348 Score = 35.4 bits (80), Expect = 0.20 Identities = 21/48 (43%), Positives = 32/48 (66%), Gaps = 3/48 (6%) Frame = -3 Query: 467 SQSRCQNPNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRC---QSQSPS 333 S+SR ++ +RS+S + S + S+SR SRS SPSRC +S+SP+ Sbjct: 277 SRSRSRSRSRSRSRSRSPLSHSRSSRSRSPSRSRSPSRCASSRSRSPA 324
>PDE4A_DROME (Q9W4T4) cAMP-specific 3',5'-cyclic phosphodiesterase, isoform I| (EC 3.1.4.17) (Learning/memory process protein) (Protein dunce) Length = 1209 Score = 35.0 bits (79), Expect = 0.26 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 2/56 (3%) Frame = -3 Query: 473 NPSQSRCQNPNRSQSPNPSRCQNLNPSQS--RCQSRSLSPSRCQSQSPSLTQCQNQ 312 NP QS QN ++ +PNP++ N NP+Q+ RC CQ Q+ L + + Sbjct: 284 NPCQSAVQNQGQNSNPNPNQNPNTNPNQNQQRCS--------CQPQTSPLPHIKEE 331
>CWC22_MAGGR (Q52B63) Pre-mRNA-splicing factor CWC22| Length = 907 Score = 35.0 bits (79), Expect = 0.26 Identities = 21/54 (38%), Positives = 33/54 (61%) Frame = -3 Query: 473 NPSQSRCQNPNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPSLTQCQNQ 312 +PS+S ++ +RS+SP P R ++ + S SR +SRS S S +S +P Q Q Sbjct: 704 SPSRSVSRSISRSRSPAPIRGRSYSRSVSRSRSRSYSRSVSRSPTPPRRQAPAQ 757 Score = 31.6 bits (70), Expect = 2.8 Identities = 17/47 (36%), Positives = 31/47 (65%) Frame = -3 Query: 464 QSRCQNPNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPSLTQ 324 ++ ++P+RS S + SR ++ P + R SRS+S SR +S S S+++ Sbjct: 699 RNNARSPSRSVSRSISRSRSPAPIRGRSYSRSVSRSRSRSYSRSVSR 745
>SFRS6_HUMAN (Q13247) Splicing factor, arginine/serine-rich 6 (Pre-mRNA-splicing| factor SRP55) Length = 344 Score = 34.7 bits (78), Expect = 0.34 Identities = 20/48 (41%), Positives = 31/48 (64%), Gaps = 3/48 (6%) Frame = -3 Query: 467 SQSRCQNPNRSQSP---NPSRCQNLNPSQSRCQSRSLSPSRCQSQSPS 333 S+SR ++ +RS SP PS+ ++++P R SRS S SR +S+S S Sbjct: 291 SKSRSRSQSRSNSPLPVPPSKARSVSPPPKRATSRSRSRSRSKSRSRS 338
>CCNL2_XENTR (Q5BKF8) Cyclin-L2| Length = 497 Score = 34.3 bits (77), Expect = 0.44 Identities = 19/43 (44%), Positives = 27/43 (62%) Frame = -3 Query: 464 QSRCQNPNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSP 336 QS ++ +RSQSP + Q+ +PS S+S SPSR +S SP Sbjct: 370 QSYSRSQSRSQSPKRRKSQSYSPSS---DSKSRSPSRSRSDSP 409
>CWC22_YARLI (Q6C8C5) Pre-mRNA-splicing factor CWC22| Length = 954 Score = 33.9 bits (76), Expect = 0.57 Identities = 19/45 (42%), Positives = 29/45 (64%) Frame = -3 Query: 467 SQSRCQNPNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPS 333 S+SR ++ +R ++ +P R + + S SR SRS S SR S+SPS Sbjct: 830 SRSRSRSLSRDRTGSPPRGRRRSRSYSRSPSRSYSRSRSYSRSPS 874 Score = 30.4 bits (67), Expect = 6.3 Identities = 12/36 (33%), Positives = 24/36 (66%) Frame = -3 Query: 473 NPSQSRCQNPNRSQSPNPSRCQNLNPSQSRCQSRSL 366 +PS+S C++PN+ ++P P + L+P + R ++ L Sbjct: 920 SPSRSPCRSPNKGRAPTPEK--GLSPPRKRVRASDL 953
>SFRS4_MOUSE (Q8VE97) Splicing factor, arginine/serine-rich 4| Length = 489 Score = 33.9 bits (76), Expect = 0.57 Identities = 18/54 (33%), Positives = 36/54 (66%), Gaps = 1/54 (1%) Frame = -3 Query: 473 NPS-QSRCQNPNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPSLTQCQN 315 NP ++R ++ ++S+ P+ ++ + S S+ +SRS SPSR S+SPS ++ ++ Sbjct: 432 NPEPRARSRSTSKSKPNVPAESRSRSKSASKTRSRSKSPSRSASRSPSRSRSRS 485 Score = 30.8 bits (68), Expect = 4.9 Identities = 15/35 (42%), Positives = 24/35 (68%) Frame = -3 Query: 467 SQSRCQNPNRSQSPNPSRCQNLNPSQSRCQSRSLS 363 S+S+ + RS+S +PSR + +PS+SR +S S S Sbjct: 455 SRSKSASKTRSRSKSPSRSASRSPSRSRSRSHSRS 489
>RSP3_CAEEL (Q9NEW6) Probable splicing factor, arginine/serine-rich 3 (CeSF2)| (CeSF2/ASF) Length = 258 Score = 33.5 bits (75), Expect = 0.75 Identities = 20/45 (44%), Positives = 27/45 (60%) Frame = -3 Query: 467 SQSRCQNPNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPS 333 S+SR R SP S ++ + S+SR +SRS S SR S+SPS Sbjct: 212 SRSRSPRAERRASPKYSPRRSRSRSRSRSRSRSRSASRSPSRSPS 256
>UAFA_STAS1 (Q4A0V8) Uro-adherence factor A precursor| Length = 2316 Score = 32.7 bits (73), Expect = 1.3 Identities = 20/54 (37%), Positives = 34/54 (62%) Frame = -3 Query: 476 LNPSQSRCQNPNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPSLTQCQN 315 L+ S+S Q+ + SQS + S ++L+ S+S +S SLS S S S SL++ ++ Sbjct: 1723 LSTSESLRQSESLSQSLSLSASESLSASESISESESLSESESLSASESLSESES 1776 Score = 31.6 bits (70), Expect = 2.8 Identities = 17/54 (31%), Positives = 34/54 (62%) Frame = -3 Query: 476 LNPSQSRCQNPNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPSLTQCQN 315 L+ S+S ++ + S+S + S ++L+ S+S +S SLS SQS +L++ ++ Sbjct: 1303 LSESESLSESESLSESESLSASESLSESESLSESESLSARESLSQSEALSESES 1356
>RSP1_CAEEL (Q23121) Probable splicing factor, arginine/serine-rich 1| (RNA-binding protein srp-5) (CeSRp75) Length = 312 Score = 32.7 bits (73), Expect = 1.3 Identities = 19/45 (42%), Positives = 30/45 (66%) Frame = -3 Query: 467 SQSRCQNPNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPS 333 S+S ++ +RS+SP P R + + S+SR +SRS S +S+SPS Sbjct: 228 SRSSSRSKSRSRSP-PKRSRRESKSKSRSRSRSRSADNRKSRSPS 271
>NKTR_HUMAN (P30414) NK-tumor recognition protein (Natural-killer cells| cyclophilin-related protein) (NK-TR protein) Length = 1462 Score = 32.3 bits (72), Expect = 1.7 Identities = 21/50 (42%), Positives = 33/50 (66%), Gaps = 3/50 (6%) Frame = -3 Query: 467 SQSRCQNPNR---SQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPSLT 327 S S Q P+R SQS +PSR ++ + ++SR ++RS+S S +S+S S T Sbjct: 1296 SSSDEQTPSRDDDSQSRSPSRSRSKSETKSRHRTRSVSYSHSRSRSRSST 1345
>SFRS5_HUMAN (Q13243) Splicing factor, arginine/serine-rich 5 (Pre-mRNA-splicing| factor SRP40) (Delayed-early protein HRS) Length = 272 Score = 32.3 bits (72), Expect = 1.7 Identities = 20/45 (44%), Positives = 32/45 (71%), Gaps = 1/45 (2%) Frame = -3 Query: 467 SQSRCQNPNRSQSPNPSRCQ-NLNPSQSRCQSRSLSPSRCQSQSP 336 S+SR ++ +RS+S + SR + + + S+SR +SRS S SR S+SP Sbjct: 190 SRSRTRSSSRSRSRSRSRSRKSYSRSRSRSRSRSRSKSRSVSRSP 234
>SFRS4_HUMAN (Q08170) Splicing factor, arginine/serine-rich 4 (Pre-mRNA-splicing| factor SRP75) (SRP001LB) Length = 494 Score = 32.3 bits (72), Expect = 1.7 Identities = 17/51 (33%), Positives = 34/51 (66%) Frame = -3 Query: 467 SQSRCQNPNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPSLTQCQN 315 ++SR ++ ++S+ PS ++ + S S+ +SRS S SR S+SPS ++ ++ Sbjct: 440 TRSRSRSNSKSKPNLPSESRSRSKSASKTRSRSKSRSRSASRSPSRSRSRS 490 Score = 30.8 bits (68), Expect = 4.9 Identities = 19/45 (42%), Positives = 27/45 (60%) Frame = -3 Query: 467 SQSRCQNPNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPS 333 S+SR +RS+S + + + S+SR SRS S SR +SQS S Sbjct: 196 SRSRHSRKSRSRSGSSKSSHSKSRSRSRSGSRSRSKSRSRSQSRS 240
>YL116_MIMIV (Q5UPJ3) Hypothetical protein L116| Length = 563 Score = 32.3 bits (72), Expect = 1.7 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 4/50 (8%) Frame = -3 Query: 473 NPSQSRCQNPNRSQSPNPSRCQNLNPSQSRC----QSRSLSPSRCQSQSP 336 +P +SR ++P RS+ +P R + +P +SR +SR SP R +SP Sbjct: 139 SPERSRYRSPERSRYRSPERSRYRSPERSRYRSPERSRYRSPERSHYRSP 188 Score = 31.2 bits (69), Expect = 3.7 Identities = 18/51 (35%), Positives = 30/51 (58%), Gaps = 4/51 (7%) Frame = -3 Query: 476 LNPSQSRCQNPNRSQSPNPSRCQNLNPSQSRC----QSRSLSPSRCQSQSP 336 L+ +SR ++P RS+ +P R + +P +SR +SR SP R + +SP Sbjct: 130 LSSERSRYRSPERSRYRSPERSRYRSPERSRYRSPERSRYRSPERSRYRSP 180
>SFRS5_RAT (Q09167) Splicing factor, arginine/serine-rich 5 (Pre-mRNA-splicing| factor SRP40) (Insulin-induced growth response protein CL-4) (Delayed-early protein HRS) Length = 269 Score = 32.0 bits (71), Expect = 2.2 Identities = 20/44 (45%), Positives = 32/44 (72%) Frame = -3 Query: 467 SQSRCQNPNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSP 336 S+SR ++ +RS+S + SR ++ + S+SR +SRS S SR S+SP Sbjct: 189 SRSRTRSSSRSRSRSRSR-RSKSYSRSRSRSRSRSKSRSGSRSP 231
>K10_DROME (P13468) DNA-binding protein K10 (Female sterile protein K10)| Length = 463 Score = 31.6 bits (70), Expect = 2.8 Identities = 15/47 (31%), Positives = 30/47 (63%), Gaps = 1/47 (2%) Frame = -3 Query: 473 NPSQSRCQNPNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRC-QSQSP 336 +P+Q + +PN+ Q PN ++ Q+L+P+Q + + + + + QSQ P Sbjct: 148 SPNQQQHPSPNQQQHPNSNQQQHLSPNQQQGKMNNQNNNHMNQSQQP 194 Score = 31.2 bits (69), Expect = 3.7 Identities = 15/48 (31%), Positives = 31/48 (64%), Gaps = 4/48 (8%) Frame = -3 Query: 473 NPSQSRCQNPNRSQSPNPSRCQNLNPSQSR----CQSRSLSPSRCQSQ 342 +P+Q + +PN+ Q P+P++ Q+ +P+Q + Q + LSP++ Q + Sbjct: 132 SPNQQQPPSPNQQQHPSPNQQQHPSPNQQQHPNSNQQQHLSPNQQQGK 179
>SYNJ1_HUMAN (O43426) Synaptojanin-1 (EC 3.1.3.36) (Synaptic| inositol-1,4,5-trisphosphate 5-phosphatase 1) Length = 1575 Score = 31.6 bits (70), Expect = 2.8 Identities = 18/54 (33%), Positives = 25/54 (46%) Frame = -3 Query: 476 LNPSQSRCQNPNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPSLTQCQN 315 L PS S + S SP S CQ+ S+ S + PSR S++P Q+ Sbjct: 1030 LQPSSSSGLGTSPSSSPRTSPCQSPTISEGPVPSLPIRPSRAPSRTPGPPSAQS 1083
>SFR16_MOUSE (Q8CFC7) Splicing factor, arginine/serine-rich 16 (Suppressor of| white-apricot homolog 2) (Clk4-associating SR-related protein) Length = 653 Score = 31.6 bits (70), Expect = 2.8 Identities = 19/46 (41%), Positives = 25/46 (54%) Frame = -3 Query: 470 PSQSRCQNPNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPS 333 P + S S +PSR +++ S SR QSRS S S+ SQS S Sbjct: 465 PRHHSSSHSRSSWSLSPSRSRSVTRSGSRSQSRSRSRSQSHSQSQS 510
>NO20_MEDTR (P93329) Early nodulin 20 precursor (N-20)| Length = 268 Score = 31.6 bits (70), Expect = 2.8 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = -3 Query: 473 NPSQSRCQNPNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPS 333 +PS S +P + P+P + +PS S S+S SPS S +PS Sbjct: 170 SPSPSPSPSPRSTPIPHPRKRSPASPSPSPSLSKSPSPSESPSLAPS 216
>H6ST2_HUMAN (Q96MM7) Heparan-sulfate 6-O-sulfotransferase 2 (EC 2.8.2.-)| (HS6ST-2) Length = 605 Score = 31.2 bits (69), Expect = 3.7 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 1/52 (1%) Frame = -3 Query: 464 QSRCQNPNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQS-QSPSLTQCQNQ 312 Q + QNPN++QS NP+ N N +Q+ Q+ + S S+ ++ +SP + Q Sbjct: 535 QGQSQNPNQNQSQNPNPNANQNLTQNLMQNLTQSLSQKENRESPKQNSGKEQ 586
>SRBS1_MOUSE (Q62417) Sorbin and SH3 domain-containing protein 1 (Ponsin)| (c-Cbl-associated protein) (CAP) (SH3 domain protein 5) (SH3P12) Length = 1290 Score = 31.2 bits (69), Expect = 3.7 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = -3 Query: 431 SPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPSLTQCQNQ 312 S +PSR ++P Q + Q R ++P R Q PSL C Q Sbjct: 1199 SSSPSRSATVSPQQPQAQQRRVTPDRSQ---PSLDLCSYQ 1235
>SFRS2_CHICK (P30352) Splicing factor, arginine/serine-rich 2 (Splicing factor| SC35) (SC-35) (Splicing component, 35 kDa) (PR264 protein) Length = 221 Score = 30.8 bits (68), Expect = 4.9 Identities = 19/47 (40%), Positives = 30/47 (63%) Frame = -3 Query: 467 SQSRCQNPNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPSLT 327 S+SR ++ +RS S + S ++ + S S +SRS S SR +S+SP T Sbjct: 149 SRSRTRSRSRSTSKSRSARRSKSKSSSVSRSRSRSRSRSRSRSPPPT 195
>SFRS2_RAT (Q6PDU1) Splicing factor, arginine/serine-rich 2 (Splicing factor| SC35) (SC-35) (Splicing component, 35 kDa) Length = 220 Score = 30.4 bits (67), Expect = 6.3 Identities = 18/44 (40%), Positives = 29/44 (65%) Frame = -3 Query: 467 SQSRCQNPNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSP 336 S+SR ++ +RS S + S ++ + S S +SRS S SR +S+SP Sbjct: 148 SRSRTRSRSRSTSKSRSARRSKSKSSSVSRSRSRSRSRSRSRSP 191
>SFRS2_PANTR (Q5R1W5) Splicing factor, arginine/serine-rich 2 (Splicing factor| SC35) (SC-35) (Splicing component, 35 kDa) Length = 220 Score = 30.4 bits (67), Expect = 6.3 Identities = 18/44 (40%), Positives = 29/44 (65%) Frame = -3 Query: 467 SQSRCQNPNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSP 336 S+SR ++ +RS S + S ++ + S S +SRS S SR +S+SP Sbjct: 148 SRSRTRSRSRSTSKSRSARRSKSKSSSVSRSRSRSRSRSRSRSP 191
>SFRS2_MOUSE (Q62093) Splicing factor, arginine/serine-rich 2 (Splicing factor| SC35) (SC-35) (Splicing component, 35 kDa) (PR264 protein) (Putative myelin regulatory factor 1) (MRF-1) Length = 220 Score = 30.4 bits (67), Expect = 6.3 Identities = 18/44 (40%), Positives = 29/44 (65%) Frame = -3 Query: 467 SQSRCQNPNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSP 336 S+SR ++ +RS S + S ++ + S S +SRS S SR +S+SP Sbjct: 148 SRSRTRSRSRSTSKSRSARRSKSKSSSVSRSRSRSRSRSRSRSP 191
>SFRS2_HUMAN (Q01130) Splicing factor, arginine/serine-rich 2 (Splicing factor| SC35) (SC-35) (Splicing component, 35 kDa) (PR264 protein) Length = 220 Score = 30.4 bits (67), Expect = 6.3 Identities = 18/44 (40%), Positives = 29/44 (65%) Frame = -3 Query: 467 SQSRCQNPNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSP 336 S+SR ++ +RS S + S ++ + S S +SRS S SR +S+SP Sbjct: 148 SRSRTRSRSRSTSKSRSARRSKSKSSSVSRSRSRSRSRSRSRSP 191
>NCAP_CVCAE (Q04700) Nucleocapsid protein (N structural protein) (NC)| Length = 382 Score = 30.4 bits (67), Expect = 6.3 Identities = 16/29 (55%), Positives = 20/29 (68%) Frame = -3 Query: 425 NPSRCQNLNPSQSRCQSRSLSPSRCQSQS 339 N SR + +PSQSR QSR+ S SR + QS Sbjct: 154 NQSRDNSRSPSQSRSQSRNRSQSRGRQQS 182
>SFRS5_MOUSE (O35326) Splicing factor, arginine/serine-rich 5 (Pre-mRNA-splicing| factor SRP40) (Delayed-early protein HRS) Length = 270 Score = 30.4 bits (67), Expect = 6.3 Identities = 20/44 (45%), Positives = 31/44 (70%) Frame = -3 Query: 467 SQSRCQNPNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSP 336 S+SR ++ RS+S + SR ++ + S+SR +SRS S SR S+SP Sbjct: 190 SRSRTRSSLRSRSRSRSR-RSKSYSRSRSRSRSRSKSRSGSRSP 232
>VE2_HPV17 (P36785) Regulatory protein E2| Length = 452 Score = 30.4 bits (67), Expect = 6.3 Identities = 18/44 (40%), Positives = 26/44 (59%) Frame = -3 Query: 464 QSRCQNPNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPS 333 + R + + S+SPN R + +R QSRSLS SR +S+S S Sbjct: 287 RERSYSRDSSRSPNRGRGGSSGGPTTRSQSRSLSRSRSRSRSRS 330
>TARA_HUMAN (Q9H2D6) TRIO and F-actin-binding protein (Protein Tara)| (Trio-associated repeat on actin) Length = 2365 Score = 30.4 bits (67), Expect = 6.3 Identities = 20/53 (37%), Positives = 24/53 (45%), Gaps = 2/53 (3%) Frame = -3 Query: 473 NPSQSRCQNPNRSQSPNP--SRCQNLNPSQSRCQSRSLSPSRCQSQSPSLTQC 321 NP SR +PNR+ NP S Q NP R+ SP+R Q T C Sbjct: 607 NPRASRTSSPNRATRDNPRTSCAQRDNP-------RASSPNRTTQQDSPRTSC 652 Score = 30.4 bits (67), Expect = 6.3 Identities = 21/53 (39%), Positives = 26/53 (49%), Gaps = 2/53 (3%) Frame = -3 Query: 473 NPSQSRCQNPNRSQSPNP--SRCQNLNPSQSRCQSRSLSPSRCQSQSPSLTQC 321 NP SR +PNR+ NP S Q NP R+ SPSR +P+ T C Sbjct: 411 NPKASRTSSPNRATRDNPRTSCAQRDNP-------RASSPSRATRDNPT-TSC 455 Score = 30.0 bits (66), Expect = 8.3 Identities = 21/53 (39%), Positives = 26/53 (49%), Gaps = 2/53 (3%) Frame = -3 Query: 473 NPSQSRCQNPNRSQSPNP--SRCQNLNPSQSRCQSRSLSPSRCQSQSPSLTQC 321 NP SR +PNR+ NP S Q NP R+ SPSR +P+ T C Sbjct: 460 NPRASRTSSPNRATRDNPRTSCAQRDNP-------RASSPSRATRDNPT-TSC 504
>VE2_HPV12 (P36782) Regulatory protein E2| Length = 494 Score = 30.0 bits (66), Expect = 8.3 Identities = 18/54 (33%), Positives = 34/54 (62%), Gaps = 2/54 (3%) Frame = -3 Query: 467 SQSRCQNPNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQ--SQSPSLTQCQNQ 312 S++R Q + +S + R Q+ + S+S+ Q+R+L + S+SPS+TQ +N+ Sbjct: 250 SRTRRQETQQRRSRSRYRSQSNSRSRSQSQTRALGATSVSRSSRSPSVTQIRNR 303
>CWC22_ASPFU (Q4WKB9) Pre-mRNA-splicing factor cwc22| Length = 881 Score = 30.0 bits (66), Expect = 8.3 Identities = 19/52 (36%), Positives = 35/52 (67%), Gaps = 1/52 (1%) Frame = -3 Query: 467 SQSRCQNPNRSQSPNPSRCQNLNPSQSRCQSRSLS-PSRCQSQSPSLTQCQN 315 S+SR ++ + S+SP+ SR + + S+ R SRS+S SR +S +PS ++ ++ Sbjct: 656 SRSRSRSYSYSRSPSRSRGRRRSISRGRSYSRSVSGSSRGRSYTPSYSRSRS 707 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,703,845 Number of Sequences: 219361 Number of extensions: 754432 Number of successful extensions: 3543 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 2600 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3371 length of database: 80,573,946 effective HSP length: 110 effective length of database: 56,444,236 effective search space used: 8184414220 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
