| Clone Name | rbags7d02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | VGLB_HSV2S (P24994) Glycoprotein B precursor | 30 | 6.2 | 2 | COX2_LOCMI (P14573) Cytochrome c oxidase subunit 2 (EC 1.9.3.1) ... | 30 | 6.2 | 3 | FLR4_CAEEL (Q9NLA1) Serine/threonine-protein kinase flr-4 (EC 2.... | 30 | 8.1 |
|---|
>VGLB_HSV2S (P24994) Glycoprotein B precursor| Length = 885 Score = 30.0 bits (66), Expect = 6.2 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = -1 Query: 613 LLENKARRAELALYVLPPCRRISMVYIDQPPPSPK 509 L E KAR + YV PP ++V +QP P P+ Sbjct: 82 LREIKARDGDATFYVCPPPTGATVVQFEQPRPCPR 116
>COX2_LOCMI (P14573) Cytochrome c oxidase subunit 2 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide II) Length = 227 Score = 30.0 bits (66), Expect = 6.2 Identities = 23/59 (38%), Positives = 30/59 (50%), Gaps = 8/59 (13%) Frame = -2 Query: 345 SYSYLHTLNVLEQSKTHPTPENGLPTSETYTLE-----SIPGL*ELRV---TSKILHPW 193 SY Y +NV + T+ TPEN L T E LE ++P E+RV S +LH W Sbjct: 107 SYEYSDFINV--EFDTYMTPENELNTDEFRLLEVDNRTTLPMNTEVRVLTSASDVLHSW 163
>FLR4_CAEEL (Q9NLA1) Serine/threonine-protein kinase flr-4 (EC 2.7.11.1)| (Fluoride resistant protein 4) Length = 570 Score = 29.6 bits (65), Expect = 8.1 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +2 Query: 236 PGIDSRVYVSDVGRPFSGVGCVFDCSNTF 322 P IDS Y+ D+G+ G C F NTF Sbjct: 35 PSIDSYKYIQDLGKGRFGTVCKFSNGNTF 63 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 110,926,991 Number of Sequences: 219361 Number of extensions: 2632490 Number of successful extensions: 6351 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6042 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6345 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6143359464 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)