| Clone Name | rbags6m14 |
|---|---|
| Clone Library Name | barley_pub |
>CLPP1_ANASP (Q8YXH5) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 204 Score = 32.7 bits (73), Expect = 0.67 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -3 Query: 536 FMSPXXAKDYGIIDSIID 483 FMSP AKDYG+ID +ID Sbjct: 173 FMSPDEAKDYGLIDQVID 190
>CLPP_AQUAE (O67357) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 201 Score = 31.6 bits (70), Expect = 1.5 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = -3 Query: 536 FMSPXXAKDYGIIDSIIDE 480 FMSP AKDYG+ID +I++ Sbjct: 181 FMSPYEAKDYGLIDKVIEK 199
>LAX2_MEDTR (Q9FEL7) Auxin transporter-like protein 2 (AUX1-like protein 2)| (MtLAX2) Length = 484 Score = 31.6 bits (70), Expect = 1.5 Identities = 19/57 (33%), Positives = 28/57 (49%) Frame = -1 Query: 187 RSVCLAGTRRLAVVLFVCLYCNIIFPVYG*FIDTCSATTLSWAEYSXPSWXYFVLLR 17 RS+CL RL VV+ + + IIFP +G A +S+ Y PS + + R Sbjct: 347 RSICLRALARLPVVIPI-WFLAIIFPFFGPINSAVGALLVSFTVYIIPSAAHMLTYR 402
>ZN710_MOUSE (Q3U288) Zinc finger protein 710| Length = 666 Score = 31.2 bits (69), Expect = 1.9 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = -1 Query: 301 RPHQLEICLTAYSITMGLGSKMWLXXQARAYNVQFSGR 188 RPH+ ++C A++ T L M L + + Y+ F GR Sbjct: 351 RPHKCQVCHKAFTQTSHLKRHMLLHSEVKPYSCHFCGR 388
>ZN710_HUMAN (Q8N1W2) Zinc finger protein 710| Length = 664 Score = 31.2 bits (69), Expect = 1.9 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = -1 Query: 301 RPHQLEICLTAYSITMGLGSKMWLXXQARAYNVQFSGR 188 RPH+ ++C A++ T L M L + + Y+ F GR Sbjct: 349 RPHKCQVCHKAFTQTSHLKRHMLLHSEVKPYSCHFCGR 386
>CLPP2_SYNPX (Q7U6N7) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 197 Score = 30.4 bits (67), Expect = 3.3 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = -3 Query: 536 FMSPXXAKDYGIIDSIIDE 480 FMSP A +YG+IDS+ID+ Sbjct: 172 FMSPGEAVEYGLIDSVIDK 190
>CLPP_GEOSL (Q74C82) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 199 Score = 29.6 bits (65), Expect = 5.6 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -3 Query: 536 FMSPXXAKDYGIIDSIID 483 FMS AKDYGIID+II+ Sbjct: 173 FMSGAEAKDYGIIDNIIE 190
>CLPP3_PROMM (Q7V7R2) ATP-dependent Clp protease proteolytic subunit 3 (EC| 3.4.21.92) (Endopeptidase Clp 3) Length = 197 Score = 29.3 bits (64), Expect = 7.4 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = -3 Query: 536 FMSPXXAKDYGIIDSIIDE 480 FMSP A YG++DS+ID+ Sbjct: 172 FMSPAEAVGYGLVDSVIDK 190
>CR1EA_BACTX (Q57458) Pesticidal crystal protein cry1Ea (Insecticidal| delta-endotoxin CryIE(a)) (Crystaline entomocidal protoxin) (133 kDa crystal protein) Length = 1171 Score = 28.9 bits (63), Expect = 9.6 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = +3 Query: 75 VALQVSINQPYTGKIILQYRHTNSTTANLRV 167 V+LQV+IN P T + L++R+ +S A + V Sbjct: 502 VSLQVNINSPITQRYRLRFRYASSRDARITV 532 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,216,427 Number of Sequences: 219361 Number of extensions: 1362204 Number of successful extensions: 2979 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 2911 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2979 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4258037034 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)