| Clone Name | rbags6m04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HXD3_CHICK (O93353) Homeobox protein Hox-D3 | 31 | 3.1 | 2 | HXA3_CHICK (Q7T3J5) Homeobox protein Hox-A3 | 31 | 3.1 | 3 | MBD6_HUMAN (Q96DN6) Methyl-CpG-binding domain protein 6 (Methyl-... | 30 | 9.0 |
|---|
>HXD3_CHICK (O93353) Homeobox protein Hox-D3| Length = 413 Score = 31.2 bits (69), Expect = 3.1 Identities = 20/60 (33%), Positives = 26/60 (43%) Frame = +2 Query: 485 LPSSPMKSRSLPSPQMQPRYLPSPIQCLFLHSFQMQPLFPQSCQMQSLQSSNPSHLVETR 664 LPS P++ L PQ P+ P+P Q QP P S SSNP+ T+ Sbjct: 74 LPSQPLQPPGLTDPQAPPQPPPAP---------QAQPPPPSSASPSQNASSNPAPANSTK 124
>HXA3_CHICK (Q7T3J5) Homeobox protein Hox-A3| Length = 413 Score = 31.2 bits (69), Expect = 3.1 Identities = 20/60 (33%), Positives = 26/60 (43%) Frame = +2 Query: 485 LPSSPMKSRSLPSPQMQPRYLPSPIQCLFLHSFQMQPLFPQSCQMQSLQSSNPSHLVETR 664 LPS P++ L PQ P+ P+P Q QP P S SSNP+ T+ Sbjct: 74 LPSQPLQPPGLTDPQAPPQPPPAP---------QAQPPPPSSASPSQNASSNPAPANSTK 124
>MBD6_HUMAN (Q96DN6) Methyl-CpG-binding domain protein 6 (Methyl-CpG-binding| protein MBD6) Length = 1003 Score = 29.6 bits (65), Expect = 9.0 Identities = 18/55 (32%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Frame = +2 Query: 488 PSSPMKSRS-LPSPQMQPRYLPSPIQCLFLHSFQMQPLFPQSCQMQSLQSSNPSH 649 P +P +SR P+P QP LP P QP+ P + L + PSH Sbjct: 381 PQTPRRSRPRAPAPVPQPFSLPEP----------SQPILPSVLSLLGLPTPGPSH 425 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 76,015,169 Number of Sequences: 219361 Number of extensions: 1392054 Number of successful extensions: 3655 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3424 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3626 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6825954960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)