| Clone Name | rbags7b03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HNF1B_PIG (Q03365) Hepatocyte nuclear factor 1-beta (HNF-1beta) ... | 30 | 4.9 | 2 | HNF1B_MOUSE (P27889) Hepatocyte nuclear factor 1-beta (HNF-1beta... | 30 | 6.3 | 3 | COX1_RHILE (Q08855) Cytochrome c oxidase subunit 1 (EC 1.9.3.1) ... | 30 | 8.3 |
|---|
>HNF1B_PIG (Q03365) Hepatocyte nuclear factor 1-beta (HNF-1beta) (HNF-1B)| (Variant hepatic nuclear factor 1) (VHNF1) (FPC-binding protein) (FPCB) Length = 559 Score = 30.4 bits (67), Expect = 4.9 Identities = 16/41 (39%), Positives = 24/41 (58%) Frame = +3 Query: 81 LLHPANKLQMSIYSLHISGGGIHLQSSNKVTHHLNHHYPEE 203 LL P K+Q+S+ SGGG+ S+ H L+HH P++ Sbjct: 396 LLSPDGKMQISV-----SGGGLPPVSTLTNIHSLSHHNPQQ 431
>HNF1B_MOUSE (P27889) Hepatocyte nuclear factor 1-beta (HNF-1beta) (HNF-1B)| (Variant hepatic nuclear factor 1) (VHNF1) (Homeoprotein LFB3) Length = 558 Score = 30.0 bits (66), Expect = 6.3 Identities = 15/42 (35%), Positives = 26/42 (61%) Frame = +3 Query: 78 ALLHPANKLQMSIYSLHISGGGIHLQSSNKVTHHLNHHYPEE 203 +LL P +K+Q+++ SGGG+ S+ H L+HH P++ Sbjct: 394 SLLSPDSKMQITV-----SGGGLPPVSTLTNIHSLSHHNPQQ 430
>COX1_RHILE (Q08855) Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide I) (Cytochrome aa3 subunit 1) Length = 538 Score = 29.6 bits (65), Expect = 8.3 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +3 Query: 87 HPANKLQMSIYSLHISGGGIHLQSSNKVTHHLNHHYP 197 HP + ++I+SLHI+G L + N +T LN P Sbjct: 163 HPGPAVDLAIFSLHIAGASSILGAINFITTILNMRAP 199 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 96,719,496 Number of Sequences: 219361 Number of extensions: 1992179 Number of successful extensions: 4423 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4288 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4420 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6257125380 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)