| Clone Name | rbags6k18 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y5258_ARATH (Q9FK81) Protein At5g22580 | 37 | 0.015 | 2 | POP3_ARATH (Q9LUV2) Putative Pop3 protein | 30 | 1.1 | 3 | GLPF_MYCGE (P47279) Probable glycerol uptake facilitator protein | 28 | 6.8 | 4 | ADFP_MOUSE (P43883) Adipophilin (Adipose differentiation-related... | 28 | 6.8 | 5 | AROK_CHLMU (Q9PK27) Shikimate kinase (EC 2.7.1.71) (SK) | 27 | 8.9 | 6 | SYD_THEAC (Q9HJM1) Aspartyl-tRNA synthetase (EC 6.1.1.12) (Aspar... | 27 | 8.9 |
|---|
>Y5258_ARATH (Q9FK81) Protein At5g22580| Length = 111 Score = 36.6 bits (83), Expect = 0.015 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = -2 Query: 390 ACMGHEKHSAFAATFMAVLDKVVVLDFPFVVAK 292 A H H F+A F AV+DK+V+LDFP K Sbjct: 72 AFTSHPLHVEFSAAFTAVIDKIVLLDFPVAAVK 104
>POP3_ARATH (Q9LUV2) Putative Pop3 protein| Length = 109 Score = 30.4 bits (67), Expect = 1.1 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -2 Query: 402 EDLAACMGHEKHSAFAATFMAVLDKVVVLDF 310 E +A + H H FA F+ LDKV+V+D+ Sbjct: 72 EAVAEYIAHPAHVEFATIFLGSLDKVLVIDY 102
>GLPF_MYCGE (P47279) Probable glycerol uptake facilitator protein| Length = 258 Score = 27.7 bits (60), Expect = 6.8 Identities = 10/20 (50%), Positives = 15/20 (75%), Gaps = 1/20 (5%) Frame = +1 Query: 163 GWWLLHEMVGTFQTVV-GDG 219 GWW L E++GTF ++ G+G Sbjct: 10 GWWFLAELIGTFILIIFGNG 29
>ADFP_MOUSE (P43883) Adipophilin (Adipose differentiation-related protein)| (ADRP) Length = 425 Score = 27.7 bits (60), Expect = 6.8 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -2 Query: 270 QYPTLVSVCYQASKHLRTITNHCLKGA 190 QYP L SVC A K ++T+T+ + A Sbjct: 39 QYPYLRSVCEMAEKGVKTVTSAAMTSA 65
>AROK_CHLMU (Q9PK27) Shikimate kinase (EC 2.7.1.71) (SK)| Length = 184 Score = 27.3 bits (59), Expect = 8.9 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 6/47 (12%) Frame = -2 Query: 327 VVVLDFPFVVA------KPAPSA*TQYPTLVSVCYQASKHLRTITNH 205 +V+LD PF KP P + P+L + +Q + LR +T H Sbjct: 105 LVLLDLPFATLYQRLQKKPLPESLKNTPSLENALFQRLEKLRLLTPH 151
>SYD_THEAC (Q9HJM1) Aspartyl-tRNA synthetase (EC 6.1.1.12) (Aspartate--tRNA| ligase) (AspRS) Length = 428 Score = 27.3 bits (59), Expect = 8.9 Identities = 15/51 (29%), Positives = 24/51 (47%) Frame = +3 Query: 132 IHSCSLQIDRWMVAIT*NGRHLSDSGW*WYVDAYLLGNRQIPGWGTGFKRM 284 +H + I R+ N + L + +YVDA+ G GWG G +R+ Sbjct: 359 VHDPKMLIQRF------NEKKLDVKSFQFYVDAFKYGMPPHAGWGLGLERL 403 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,137,151 Number of Sequences: 219361 Number of extensions: 847596 Number of successful extensions: 1790 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1773 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1790 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 1359926328 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)