| Clone Name | rbags6j14 |
|---|---|
| Clone Library Name | barley_pub |
>NORK_PEA (Q8LKZ1) Nodulation receptor kinase precursor (EC 2.7.11.1)| Length = 924 Score = 38.1 bits (87), Expect = 0.023 Identities = 20/58 (34%), Positives = 32/58 (55%) Frame = -2 Query: 653 LDQIVDPYLKGKIVPQCFKKFAETAEKCVADNGIERPSMGDVLWNLEFALQMQESAEE 480 +D+IVDP +KG + + E A +C+ RP M D++ LE AL ++ +A E Sbjct: 822 VDEIVDPGIKGGYHAEALWRVVEVALQCLEPYSTYRPCMVDIVRELEDALIIENNASE 879
>NORK_MEDTR (Q8L4H4) Nodulation receptor kinase precursor (EC 2.7.11.1) (Does| not make infections protein 2) (Symbiosis receptor-like kinase) (MtSYMRK) Length = 925 Score = 38.1 bits (87), Expect = 0.023 Identities = 20/58 (34%), Positives = 32/58 (55%) Frame = -2 Query: 653 LDQIVDPYLKGKIVPQCFKKFAETAEKCVADNGIERPSMGDVLWNLEFALQMQESAEE 480 +D+IVDP +KG + + E A +C+ RP M D++ LE AL ++ +A E Sbjct: 823 VDEIVDPGIKGGYHAEALWRVVEVALQCLEPYSTYRPCMVDIVRELEDALIIENNASE 880
>CRI4_MAIZE (O24585) Putative receptor protein kinase CRINKLY4 precursor (EC| 2.7.11.1) Length = 901 Score = 35.4 bits (80), Expect = 0.15 Identities = 21/49 (42%), Positives = 25/49 (51%) Frame = -2 Query: 644 IVDPYLKGKIVPQCFKKFAETAEKCVADNGIERPSMGDVLWNLEFALQM 498 I+DP L + KK A A KCV G +RPSM V LE AL + Sbjct: 736 ILDPVLSPPSDLEALKKIASVACKCVRMRGKDRPSMDKVTTALEHALAL 784
>MTH1_DROME (Q9VXD9) Probable G-protein coupled receptor Mth-like 1 precursor| (Protein methuselah-like 1) Length = 676 Score = 31.6 bits (70), Expect = 2.2 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +1 Query: 238 NKQTQIFTSPHRPLGFMICENTALGVSPSESMLATLW 348 N+ IF + P+G ++C N AL VS + + LW Sbjct: 484 NRNLSIFAYFYGPIGLLLCANIALFVSTTHQLTCGLW 520
>WASF3_HUMAN (Q9UPY6) Wiskott-Aldrich syndrome protein family member 3| (WASP-family protein member 3) (WAVE-3 protein) (Verprolin homology domain-containing protein 3) Length = 502 Score = 30.8 bits (68), Expect = 3.7 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 6/57 (10%) Frame = +2 Query: 395 QLMGHWDPSFQPSRGECPHLTSHSQCFRSP------PRFPASEEQTPSSKAHLPSKG 547 Q++ +++PS P P + S F SP P FPAS T ++ H PS G Sbjct: 333 QIIEYYNPSGPPPPPPPPVIPSAQTAFVSPLQMPMQPPFPASASSTHAAPPHPPSTG 389
>RGA2_SCHPO (Q10164) Probable Rho-type GTPase-activating protein 2| Length = 1275 Score = 30.0 bits (66), Expect = 6.3 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 4/46 (8%) Frame = +2 Query: 416 PSFQPSRGECPHLTSHSQCFRSPPRFP----ASEEQTPSSKAHLPS 541 PS QPSR P S+S + FP S + P++ AH+ S Sbjct: 126 PSSQPSRANSPQSDSYSSPYEKGKLFPKISLKSSKDVPTASAHISS 171
>V70K_EPMV (P20129) 70 kDa protein| Length = 649 Score = 29.6 bits (65), Expect = 8.2 Identities = 30/88 (34%), Positives = 35/88 (39%), Gaps = 2/88 (2%) Frame = +2 Query: 239 TSRPRFLPHLTAPW--GS*SVRTPRLASAHPSRCSRHFGHPCLRKLLWSSWCLNQLMGHW 412 T P FLP+ P G+ TPR S PS S LR L S+ + Sbjct: 517 TVPPPFLPNHLHPLLPGTDPPTTPRQLSPSPSSLS-------LRTFLDSA----VISCDS 565 Query: 413 DPSFQPSRGECPHLTSHSQCFRSPPRFP 496 P PS H +S Q SPPRFP Sbjct: 566 SPVLPPSPSPSSHSSSSFQSCTSPPRFP 593 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 87,356,042 Number of Sequences: 219361 Number of extensions: 1889699 Number of successful extensions: 4332 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 4154 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4325 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6200242422 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)