| Clone Name | rbags6h15 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SRYC_DROME (P15619) Serendipity locus protein H-1 (Protein wings... | 31 | 4.1 | 2 | KPYK_CLOAB (O08309) Pyruvate kinase (EC 2.7.1.40) (PK) | 30 | 7.0 | 3 | TRIP6_HUMAN (Q15654) Thyroid receptor-interacting protein 6 (TRI... | 30 | 7.0 | 4 | MAD1_KLULA (Q6CMM2) Spindle assembly checkpoint component MAD1 (... | 30 | 9.1 |
|---|
>SRYC_DROME (P15619) Serendipity locus protein H-1 (Protein wings-down)| (Protein pourquoi-pas) Length = 869 Score = 30.8 bits (68), Expect = 4.1 Identities = 17/56 (30%), Positives = 32/56 (57%) Frame = -3 Query: 333 QRELSQIIMKEVLEKTRMFYEEGQMSREDVRTRVAAQRLDKKPFTTLGDYLPDLHG 166 +RE Q+ K++ +K ++ ++GQ + + A ++ K+P T G +L DLHG Sbjct: 623 KRERKQLAPKQLQQKPQLL-QQGQPQQSSLEPIPAVPQIKKEPVQTQGPFL-DLHG 676
>KPYK_CLOAB (O08309) Pyruvate kinase (EC 2.7.1.40) (PK)| Length = 473 Score = 30.0 bits (66), Expect = 7.0 Identities = 27/110 (24%), Positives = 48/110 (43%), Gaps = 1/110 (0%) Frame = +1 Query: 301 LLHDDLGKFTLDVIELSSESLNWDIS*VLCPLQNMGIAGSR*HAKVLLIPSELPHVVE-D 477 L+ D L T++ IE ++ V+C + N G+ GS V + +LP + E D Sbjct: 123 LIDDGLVGLTVEAIEGTN---------VICTVANTGLVGSHKGVNVPNVSIQLPAMTEKD 173 Query: 478 IESITDSTTRLLDVVEVSLINKAGRAVPCHPVRHLSTPYDVRKDSTIENK 627 + +D+V S I K + V + + +++ S IEN+ Sbjct: 174 KSDLIFGCKEEIDMVSASFIRKPEDVLAIRKVLNENGGENIQIFSKIENQ 223
>TRIP6_HUMAN (Q15654) Thyroid receptor-interacting protein 6 (TRIP6)| (OPA-interacting protein 1) (Zyxin-related protein 1) (ZRP-1) Length = 476 Score = 30.0 bits (66), Expect = 7.0 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = -2 Query: 475 PPPHAGVQTGSAEPSHVT*IRRCPYSAMGKEPRRYPSSTTPS 350 PPP +TGS +P+ + + PY G P Y +++TP+ Sbjct: 125 PPPPPAYRTGSLKPNPASPLPASPYG--GPTPASYTTASTPA 164
>MAD1_KLULA (Q6CMM2) Spindle assembly checkpoint component MAD1 (Mitotic arrest| deficient protein 1) Length = 648 Score = 29.6 bits (65), Expect = 9.1 Identities = 15/54 (27%), Positives = 32/54 (59%), Gaps = 2/54 (3%) Frame = -3 Query: 348 EFYHIQRELSQII--MKEVLEKTRMFYEEGQMSREDVRTRVAAQRLDKKPFTTL 193 E Y +Q + + + ++ L+ T++ YEE +E+++++ A + D+K TTL Sbjct: 48 ETYSLQNKYDKSMNELENALKDTKILYEENIKLKEELKSKDALPKEDEKIITTL 101 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 98,340,274 Number of Sequences: 219361 Number of extensions: 2054149 Number of successful extensions: 5355 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5226 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5355 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 6912958834 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)