| Clone Name | rbags6e22 |
|---|---|
| Clone Library Name | barley_pub |
>SC24A_HUMAN (O95486) Protein transport protein Sec24A (SEC24-related protein A)| (Fragment) Length = 1078 Score = 33.9 bits (76), Expect = 0.47 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 4/42 (9%) Frame = -1 Query: 516 PSTPQRFWLPLLHDSVKLLNCKPH----PLLNVAETTLLLNK 403 PSTP + +P LH+ ++ LNC P L ++ +T LLNK Sbjct: 346 PSTPLKPPVPNLHEDIQKLNCNPELFRCTLTSIPQTQALLNK 387
>POLG_HCVEU (O39927) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3017 Score = 31.2 bits (69), Expect = 3.1 Identities = 27/80 (33%), Positives = 35/80 (43%), Gaps = 10/80 (12%) Frame = -1 Query: 495 WLPLLH-----DSVKLLNCKPHPLLNVAETTLLLNKLQEL-----SMAKLRPDFCSNHLP 346 W+P L DS+ LL C HP L T +LL L L S+ K+ P F H+ Sbjct: 863 WVPDLRVRGGRDSIILLTCLLHPQLGFEVTKILLAVLAPLYILQYSLLKV-PYFVRAHIL 921 Query: 345 IHALSSVRLALGSNLARAIL 286 + A VR G +A L Sbjct: 922 LRACLLVRRLAGGKYVQACL 941
>POLG_HCV6A (Q5I2N3) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3018 Score = 30.8 bits (68), Expect = 4.0 Identities = 27/80 (33%), Positives = 35/80 (43%), Gaps = 10/80 (12%) Frame = -1 Query: 495 WLPLLH-----DSVKLLNCKPHPLLNVAETTLLLNKLQEL-----SMAKLRPDFCSNHLP 346 W+P L DS+ LL C HP L T +LL L L S+ K+ P F H+ Sbjct: 864 WVPDLRVRGGRDSIILLTCLLHPQLGFEVTKILLAILAPLYILQYSLLKV-PYFVRAHIL 922 Query: 345 IHALSSVRLALGSNLARAIL 286 + A VR G +A L Sbjct: 923 LRACLLVRRLAGGRYVQACL 942
>SPT4H_CAEBR (Q628A6) Transcription elongation factor SPT4 (DRB| sensitivity-inducing factor small subunit) (DSIF small subunit) Length = 120 Score = 30.4 bits (67), Expect = 5.2 Identities = 15/57 (26%), Positives = 25/57 (43%) Frame = -3 Query: 682 GRVARATRFRHW*CRWS*VPSQVPGFQEIPSTGTRRKNRRGCSADRGVSYTANEKSF 512 G +A + W C+W + +V G I +G+ N GV Y AN++ + Sbjct: 58 GMIAAMSNDDSWVCKWQKMQRRVKGIYAISVSGSLPSNVVSDLKSMGVRYKANQRDY 114
>MURB_AGRT5 (Q8UDN0) UDP-N-acetylenolpyruvoylglucosamine reductase (EC| 1.1.1.158) (UDP-N-acetylmuramate dehydrogenase) Length = 321 Score = 30.0 bits (66), Expect = 6.9 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 4/40 (10%) Frame = +3 Query: 234 RHQTGA----NPPPDTAFKLLQEWHGRGLIPGPT*QSSVH 341 R QTG NP +A++L+ E GRGL+ G SS+H Sbjct: 226 REQTGGSTFKNPEGHSAWELIDEAGGRGLVIGGAQMSSLH 265
>EGO_ECOLI (P77257) Putative ABC transporter ATP-binding protein ego (EGO10A)| Length = 511 Score = 30.0 bits (66), Expect = 6.9 Identities = 28/80 (35%), Positives = 35/80 (43%) Frame = -1 Query: 585 ALEGRTGEAARQTVEFLIQLMRNPSTPQRFWLPLLHDSVKLLNCKPHPLLNVAETTLLLN 406 +L G A RQ VE L LMR DS L+ +P L AET L + Sbjct: 136 SLAGSLDVADRQMVEILRGLMR--------------DSRILILDEPTASLTPAETERLFS 181 Query: 405 KLQELSMAKLRPDFCSNHLP 346 +LQEL + F S+ LP Sbjct: 182 RLQELLATGVGIVFISHKLP 201
>SC24A_MOUSE (Q3U2P1) Protein transport protein Sec24A (SEC24-related protein A)| Length = 1090 Score = 29.6 bits (65), Expect = 9.0 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 4/42 (9%) Frame = -1 Query: 516 PSTPQRFWLPLLHDSVKLLNCKPH----PLLNVAETTLLLNK 403 PSTP + +P L + ++ LNC P L +V +T LLNK Sbjct: 358 PSTPLQPPVPNLLEDIQKLNCNPELFRCTLTSVPQTQALLNK 399
>PGMP_PEA (Q9SM59) Phosphoglucomutase, chloroplast precursor (EC 5.4.2.2)| (Glucose phosphomutase) (PGM) Length = 626 Score = 29.6 bits (65), Expect = 9.0 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +2 Query: 17 LXVH*XFSNMPGFLPNDTVTSTPLRIKYDRQLRSPKLKTIDGTSMAEP 160 L +H SN P F V + P R++Y+ +R+ + T++AEP Sbjct: 24 LSIHHSSSNFPSF----KVQNFPFRVRYNSAIRATSSSSSTPTTIAEP 67 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 93,096,567 Number of Sequences: 219361 Number of extensions: 1880710 Number of successful extensions: 4637 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 4463 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4636 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6769072002 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)