| Clone Name | rbags5p06 |
|---|---|
| Clone Library Name | barley_pub |
>VP13B_HUMAN (Q7Z7G8) Vacuolar protein sorting 13B (Cohen syndrome protein 1)| Length = 4022 Score = 32.3 bits (72), Expect = 0.28 Identities = 20/56 (35%), Positives = 29/56 (51%) Frame = +3 Query: 99 GVIQKMDTQQF*NVDTDHTTPANCHKAPWCRLSLGCISCILPPASPRPSSFLRIHH 266 GV +++ QQ+ N D+ T +CH AP C S I C + A P PS+ H+ Sbjct: 3943 GVRERLSEQQY-NRLVDYITKTSCHLAPSC--SSMQIPCPVVAAEPPPSTVKTYHY 3995
>VL2_HPV69 (Q9JH45) Minor capsid protein L2| Length = 467 Score = 29.6 bits (65), Expect = 1.8 Identities = 15/55 (27%), Positives = 24/55 (43%) Frame = +2 Query: 203 LHKLYITTSFSTTFKLPQNSPPAKMKFSTAL*ELTTYMQHNATVHLLSGFGTPFY 367 L +Y + TF P +P +FS+ + T+ N T+ L + F P Y Sbjct: 350 LFDVYADADPAPTFTFPSTTPTTIPRFSSTIFSTTSSAPLNVTIPLSTSFDIPIY 404
>SAYP_DROME (Q9VWF2) Supporter of activation of yellow protein (Protein| enhancer of yellow 3) Length = 2006 Score = 28.5 bits (62), Expect = 4.0 Identities = 15/40 (37%), Positives = 23/40 (57%) Frame = +3 Query: 75 VHKVDNSHGVIQKMDTQQF*NVDTDHTTPANCHKAPWCRL 194 +HK+ HGV Q+MDTQ N + T + +++P RL Sbjct: 730 IHKLAMDHGVEQRMDTQDNNNENHLKRTNSEGNESPSSRL 769
>ATRIP_DROME (Q9VVN4) ATR-interacting protein mus304 (Mutagen-sensivite protein| 304) Length = 846 Score = 28.1 bits (61), Expect = 5.2 Identities = 12/45 (26%), Positives = 25/45 (55%), Gaps = 8/45 (17%) Frame = -1 Query: 194 KPTPWSFVTVSRCCMICI---DILELLCVH-----LLYDTMRVIY 84 +P+PW F +S C + C+ +++ +CV+ + D +R +Y Sbjct: 518 RPSPWVFAELSSCFLSCLRHPQLMDKMCVNSPKDCFVSDRVRSVY 562
>POLG_HCVH (P27958) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/NT Length = 3010 Score = 27.7 bits (60), Expect = 6.8 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +1 Query: 337 PTVRFRYSFLLGMHEHPCGSSL 402 P +R SF +G+HE+P GS L Sbjct: 2138 PLLREEVSFRVGLHEYPVGSQL 2159
>POLG_HCV1 (P26664) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/NT Length = 3010 Score = 27.7 bits (60), Expect = 6.8 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +1 Query: 337 PTVRFRYSFLLGMHEHPCGSSL 402 P +R SF +G+HE+P GS L Sbjct: 2138 PLLREEVSFRVGLHEYPVGSQL 2159 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,692,972 Number of Sequences: 219361 Number of extensions: 1134091 Number of successful extensions: 2536 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2502 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2536 length of database: 80,573,946 effective HSP length: 110 effective length of database: 56,444,236 effective search space used: 1354661664 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)