| Clone Name | rbags5n11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | KCNA2_RAT (P63142) Potassium voltage-gated channel subfamily A m... | 29 | 2.8 | 2 | KCNA2_MOUSE (P63141) Potassium voltage-gated channel subfamily A... | 29 | 2.8 | 3 | KCNA2_HUMAN (P16389) Potassium voltage-gated channel subfamily A... | 29 | 2.8 | 4 | KCNA2_CANFA (Q28293) Potassium voltage-gated channel subfamily A... | 29 | 2.8 |
|---|
>KCNA2_RAT (P63142) Potassium voltage-gated channel subfamily A member 2| (Voltage-gated potassium channel subunit Kv1.2) (RBK2) (RCK5) (RAK) Length = 499 Score = 29.3 bits (64), Expect = 2.8 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 6/33 (18%) Frame = -2 Query: 164 SSIGYLXNTSFCX------CLCVLHFSFHFIVR 84 S+IGY +TSF LC++ FSF F+VR Sbjct: 208 STIGYQQSTSFTDPFFIVETLCIIWFSFEFLVR 240
>KCNA2_MOUSE (P63141) Potassium voltage-gated channel subfamily A member 2| (Voltage-gated potassium channel subunit Kv1.2) (MK2) Length = 499 Score = 29.3 bits (64), Expect = 2.8 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 6/33 (18%) Frame = -2 Query: 164 SSIGYLXNTSFCX------CLCVLHFSFHFIVR 84 S+IGY +TSF LC++ FSF F+VR Sbjct: 208 STIGYQQSTSFTDPFFIVETLCIIWFSFEFLVR 240
>KCNA2_HUMAN (P16389) Potassium voltage-gated channel subfamily A member 2| (Voltage-gated potassium channel subunit Kv1.2) (HBK5) (NGK1) (HUKIV) Length = 499 Score = 29.3 bits (64), Expect = 2.8 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 6/33 (18%) Frame = -2 Query: 164 SSIGYLXNTSFCX------CLCVLHFSFHFIVR 84 S+IGY +TSF LC++ FSF F+VR Sbjct: 208 STIGYQQSTSFTDPFFIVETLCIIWFSFEFLVR 240
>KCNA2_CANFA (Q28293) Potassium voltage-gated channel subfamily A member 2| (Voltage-gated potassium channel subunit Kv1.2) (CSMK1) Length = 499 Score = 29.3 bits (64), Expect = 2.8 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 6/33 (18%) Frame = -2 Query: 164 SSIGYLXNTSFCX------CLCVLHFSFHFIVR 84 S+IGY +TSF LC++ FSF F+VR Sbjct: 208 STIGYQQSTSFTDPFFIVETLCIIWFSFEFLVR 240 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,196,734 Number of Sequences: 219361 Number of extensions: 379587 Number of successful extensions: 473 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 468 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 473 length of database: 80,573,946 effective HSP length: 57 effective length of database: 68,070,369 effective search space used: 1633688856 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)