| Clone Name | rbags5m22 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | LAMA4_MOUSE (P97927) Laminin alpha-4 chain precursor | 32 | 0.32 | 2 | NU1M_LUMTE (Q37546) NADH-ubiquinone oxidoreductase chain 1 (EC 1... | 28 | 7.8 |
|---|
>LAMA4_MOUSE (P97927) Laminin alpha-4 chain precursor| Length = 1816 Score = 32.3 bits (72), Expect = 0.32 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -3 Query: 123 TVWCLILAARLVWLAVCWFDSLGDGS 46 T WC +LA L+W AVC + GDG+ Sbjct: 5 TAWCSVLALWLLWCAVCSNAASGDGN 30
>NU1M_LUMTE (Q37546) NADH-ubiquinone oxidoreductase chain 1 (EC 1.6.5.3) (NADH| dehydrogenase subunit 1) Length = 308 Score = 27.7 bits (60), Expect = 7.8 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 46 RPIAETVKPTYGQPNKPRC*NQTPYCFGDGVGXVL 150 +P A+ +K + KP NQTP+ F +G VL Sbjct: 50 QPFADAIKLFVKEQAKPNPSNQTPFLFAPTMGLVL 84 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,149,660 Number of Sequences: 219361 Number of extensions: 589879 Number of successful extensions: 1272 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1263 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1272 length of database: 80,573,946 effective HSP length: 74 effective length of database: 64,341,232 effective search space used: 1544189568 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)