ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbags5m14 |
|---|---|
| Clone Library Name | barley_pub |
>SPS1_CITUN (O22060) Sucrose-phosphate synthase 1 (EC 2.4.1.14)| (UDP-glucose-fructose-phosphate glucosyltransferase 1) Length = 1057 Score = 48.5 bits (114), Expect = 1e-05 Identities = 21/45 (46%), Positives = 33/45 (73%), Gaps = 1/45 (2%) Frame = -2 Query: 527 AANRIHTVRRYPLQDVVALDSSNIIEV-QGCTTEDIKSALRHIGV 396 ++N+IH R YPL DV+ +DS NI++ + CTT DI+S+L +G+ Sbjct: 1010 SSNQIHANRSYPLSDVMPIDSPNIVQTPEDCTTSDIRSSLEQLGL 1054
>SPS_SPIOL (P31928) Sucrose-phosphate synthase (EC 2.4.1.14)| (UDP-glucose-fructose-phosphate glucosyltransferase) Length = 1056 Score = 40.4 bits (93), Expect = 0.003 Identities = 16/41 (39%), Positives = 24/41 (58%) Frame = -2 Query: 521 NRIHTVRRYPLQDVVALDSSNIIEVQGCTTEDIKSALRHIG 399 + H R YP++ V+ +DS N+ + GC +DI AL IG Sbjct: 1008 SNFHATRAYPMEHVMPVDSPNMFQTGGCNIDDISDALSKIG 1048
>SPS_VICFA (Q43876) Sucrose-phosphate synthase (EC 2.4.1.14)| (UDP-glucose-fructose-phosphate glucosyltransferase) Length = 1059 Score = 40.0 bits (92), Expect = 0.004 Identities = 18/44 (40%), Positives = 30/44 (68%), Gaps = 1/44 (2%) Frame = -2 Query: 527 AANRIHTVRRYPLQDVVALDSSNIIE-VQGCTTEDIKSALRHIG 399 A +++H R YPL DV+ LDS NI++ +G ++ DI++ L +G Sbjct: 1012 AISQLHNNRNYPLSDVMPLDSPNIVQATEGSSSADIQALLEKVG 1055
>SPS_BETVU (P49031) Sucrose-phosphate synthase (EC 2.4.1.14)| (UDP-glucose-fructose-phosphate glucosyltransferase) Length = 1045 Score = 37.0 bits (84), Expect = 0.033 Identities = 19/38 (50%), Positives = 26/38 (68%), Gaps = 1/38 (2%) Frame = -2 Query: 527 AANRIHTVRRYPLQDVVALDSSNIIEV-QGCTTEDIKS 417 A +H R YPL VV+LDS NI EV +GC++ +I+S Sbjct: 1000 ALRSLHANRSYPLSHVVSLDSPNIGEVSKGCSSSEIQS 1037
>SPS_SOLTU (Q43845) Sucrose-phosphate synthase (EC 2.4.1.14)| (UDP-glucose-fructose-phosphate glucosyltransferase) Length = 1053 Score = 35.8 bits (81), Expect = 0.074 Identities = 17/45 (37%), Positives = 28/45 (62%), Gaps = 1/45 (2%) Frame = -2 Query: 527 AANRIHTVRRYPLQDVVALDSSNIIEV-QGCTTEDIKSALRHIGV 396 A++ IH R YPL DV+ DS N+I+ + C++ +I+ L + V Sbjct: 1006 ASSLIHGNRNYPLSDVLPFDSPNVIQADEECSSTEIRCLLEKLAV 1050
>SPS1_CRAPL (O04932) Sucrose-phosphate synthase 1 (EC 2.4.1.14)| (UDP-glucose-fructose-phosphate glucosyltransferase 1) Length = 1054 Score = 35.0 bits (79), Expect = 0.13 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 2/45 (4%) Frame = -2 Query: 527 AANRIHTVRRYPLQDVVALDSSNIIEV--QGCTTEDIKSALRHIG 399 A N +H R YPL DVV D NI + + C++ D+++ L G Sbjct: 1006 ATNLLHANRSYPLADVVCFDDLNIFKTHNEECSSTDLRALLEEHG 1050
>POLG_POL32 (P06209) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2205 Score = 31.6 bits (70), Expect = 1.4 Identities = 24/98 (24%), Positives = 38/98 (38%), Gaps = 20/98 (20%) Frame = +3 Query: 147 DFSAHICFPTTFIILSTSKFVNSTN--------------------KRWKLFTARGYTTPT 266 +F + F F + T+ F NS N K W +T + + P+ Sbjct: 698 EFFTYSRFDMEFTFVVTANFTNSNNGHALNQVYQIMYIPPGAPTPKSWDDYTWQTSSNPS 757 Query: 267 LYNLQTKSAFPSSMEIVALGLARTSSHFLLPFCGAPAK 380 ++ T A P+ + + +GLA SHF F P K Sbjct: 758 IF--YTYGAAPARISVPYVGLANAYSHFYDGFAKVPLK 793
>POLG_POL3L (P03302) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2205 Score = 30.4 bits (67), Expect = 3.1 Identities = 23/98 (23%), Positives = 38/98 (38%), Gaps = 20/98 (20%) Frame = +3 Query: 147 DFSAHICFPTTFIILSTSKFVNSTN--------------------KRWKLFTARGYTTPT 266 +F + F F + T+ F N+ N K W +T + + P+ Sbjct: 698 EFFTYSRFDMEFTFVVTANFTNANNGHALNQVYQIMYIPPGAPTPKSWDDYTWQTSSNPS 757 Query: 267 LYNLQTKSAFPSSMEIVALGLARTSSHFLLPFCGAPAK 380 ++ T A P+ + + +GLA SHF F P K Sbjct: 758 IF--YTYGAAPARISVPYVGLANAYSHFYDGFAKVPLK 793
>POLG_PVYYO (P11897) Genome polyprotein [Contains: Nuclear inclusion protein B| (NI-B) (NIB) (RNA-directed RNA polymerase) (EC 2.7.7.48); Coat protein (CP)] (Fragment) Length = 284 Score = 30.0 bits (66), Expect = 4.1 Identities = 21/93 (22%), Positives = 40/93 (43%) Frame = +3 Query: 240 TARGYTTPTLYNLQTKSAFPSSMEIVALGLARTSSHFLLPFCGAPAKMLLCRHTNVTQGR 419 T+ +T P + + +K P S + AL L + AP ++ + +T TQ + Sbjct: 55 TSGTHTVPRIKAITSKMRMPRSKGVAALNLEHLLEY-------APQQIDIS-NTRATQSQ 106 Query: 420 LDVLCSATLDFNDIGAVQCNDILQGVSPHCVDS 518 D A DIG + ++ G+ C+++ Sbjct: 107 FDTWYEAVRMAYDIGQTEMPTVMNGLMVWCIEN 139
>ACA13_ARATH (Q9LIK7) Putative calcium-transporting ATPase 13, plasma| membrane-type (EC 3.6.3.8) (Ca(2+)-ATPase isoform 13) Length = 1017 Score = 29.6 bits (65), Expect = 5.3 Identities = 15/54 (27%), Positives = 28/54 (51%), Gaps = 5/54 (9%) Frame = +3 Query: 183 IILSTSKFVNSTNKRWKLFTARGYTTPTLYN-----LQTKSAFPSSMEIVALGL 329 ++L K ++ +NK+W+L + Y + TL N ++ FP S+ A+ L Sbjct: 19 VLLELPKTLSKSNKKWQLALIKLYCSRTLLNCAKHAIRKPGLFPRSLSYTAIDL 72
>ZBTB1_MOUSE (Q91VL9) Zinc finger and BTB domain-containing protein 1| Length = 713 Score = 29.3 bits (64), Expect = 7.0 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -1 Query: 411 ASHWCADTITSLRVPHKREEENE 343 A+ WCA+ +++ PH RE E E Sbjct: 156 ANRWCAEPSSTVNTPHHREPEEE 178
>SYPM_HUMAN (Q7L3T8) Probable prolyl-tRNA synthetase, mitochondrial precursor| (EC 6.1.1.15) (Proline--tRNA ligase) (ProRS) Length = 475 Score = 29.3 bits (64), Expect = 7.0 Identities = 19/79 (24%), Positives = 40/79 (50%), Gaps = 9/79 (11%) Frame = -3 Query: 370 APQKGRRK*-----EEVRAKPSATISILDGNADFVCR----L*SVGVVYPRAVNNFHLLF 218 AP++GRR + + +S+ D + D C+ + VG++YP + +HLL Sbjct: 33 APRRGRRLLLSRVFQPQNLREDRVLSLQDKSDDLTCKSQRLMLQVGLIYPASPGCYHLL- 91 Query: 217 VLFTNFEVDNMINVVGKQM 161 +T ++ ++ V+ ++M Sbjct: 92 -PYTVRAMEKLVRVIDQEM 109
>RUSC2_HUMAN (Q8N2Y8) RUN and SH3 domain-containing protein 2| Length = 1516 Score = 29.3 bits (64), Expect = 7.0 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -1 Query: 519 QNPHSEEIPLAGCRCTGQ 466 Q PHS E+P AG R TGQ Sbjct: 623 QGPHSSEMPPAGLRATGQ 640
>SELD_DESVH (Q72CF1) Selenide, water dikinase (EC 2.7.9.3) (Selenophosphate| synthetase) (Selenium donor protein) Length = 351 Score = 28.9 bits (63), Expect = 9.1 Identities = 20/84 (23%), Positives = 32/84 (38%) Frame = +3 Query: 273 NLQTKSAFPSSMEIVALGLARTSSHFLLPFCGAPAKMLLCRHTNVTQGRLDVLCSATLDF 452 ++ T P+ +++VA GL SH FC + H V +D++ A Sbjct: 251 DVSTLPLMPAVLDLVATGLLPAGSHANRHFCSGNVSV----HPEVDSLLVDIVFDAQTS- 305 Query: 453 NDIGAVQCNDILQGVSPHCVDSVC 524 ++ V PH VD C Sbjct: 306 --------GGLILAVPPHLVDDAC 321 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 82,269,125 Number of Sequences: 219361 Number of extensions: 1749234 Number of successful extensions: 4263 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 4146 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4262 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4027872870 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
