| Clone Name | rbags5l16 |
|---|---|
| Clone Library Name | barley_pub |
>CWC15_EMENI (Q5B020) Pre-mRNA-splicing factor cwc15| Length = 232 Score = 76.6 bits (187), Expect = 1e-14 Identities = 35/63 (55%), Positives = 48/63 (76%), Gaps = 1/63 (1%) Frame = -1 Query: 339 ELMRGNPXINMNNSGSFNVKRRWDDDVVFKNQARG-ETXTPKRFIXDTIRSDFHRKFLHR 163 ++ RGNP +N ++ FN+KRRWDDDVVFKNQARG E K F+ D +RSDFH+KF+ + Sbjct: 173 DIARGNPLLNPSD---FNIKRRWDDDVVFKNQARGTEDKRGKEFVNDLLRSDFHKKFMSK 229 Query: 162 YMK 154 Y++ Sbjct: 230 YVR 232
>CWC15_SCHPO (P78794) Pre-mRNA-splicing factor cwc15 (Complexed with cdc5| protein 15) (Cell cycle control protein cwf15) Length = 265 Score = 70.1 bits (170), Expect = 1e-12 Identities = 32/62 (51%), Positives = 45/62 (72%), Gaps = 1/62 (1%) Frame = -1 Query: 339 ELMRGNPXINMNNSGSFNVKRRWDDDVVFKNQARGETXTPK-RFIXDTIRSDFHRKFLHR 163 E+ GN +N +SGSF VKRRWD+DVVF+N +G TP+ F+ D +RS+FH+KFL R Sbjct: 203 EIAFGNELLNKASSGSFQVKRRWDEDVVFRNTHKGVDDTPRPGFVNDMLRSEFHKKFLAR 262 Query: 162 YM 157 ++ Sbjct: 263 FV 264
>CWC15_YARLI (Q6C0E6) Pre-mRNA-splicing factor CWC15| Length = 215 Score = 55.1 bits (131), Expect = 4e-08 Identities = 25/58 (43%), Positives = 39/58 (67%) Frame = -1 Query: 327 GNPXINMNNSGSFNVKRRWDDDVVFKNQARGETXTPKRFIXDTIRSDFHRKFLHRYMK 154 GNP +N +KR+W++DVVF+NQ + + ++ D IRSDFHRKF++RY++ Sbjct: 164 GNPLMN-----PVAIKRKWNEDVVFRNQTK-QARKEDSYVNDLIRSDFHRKFMNRYVR 215
>CWC15_DEBHA (Q6BP48) Pre-mRNA-splicing factor CWC15| Length = 226 Score = 42.7 bits (99), Expect = 2e-04 Identities = 16/54 (29%), Positives = 28/54 (51%) Frame = -1 Query: 315 INMNNSGSFNVKRRWDDDVVFKNQARGETXTPKRFIXDTIRSDFHRKFLHRYMK 154 + + +F +K+ W D FK Q + F DT+ S+FH+ FL +Y++ Sbjct: 173 VGASTEANFKIKKSWRDSTAFKKQNSQNKNDDETFTNDTLNSEFHQNFLTKYIR 226
>CWC15_CANAL (Q59PD3) Pre-mRNA-splicing factor CWC15| Length = 224 Score = 35.4 bits (80), Expect = 0.035 Identities = 14/59 (23%), Positives = 29/59 (49%), Gaps = 2/59 (3%) Frame = -1 Query: 324 NPXINMNNSGSFNVKRRWDDDVVFKNQARGETXTPKR--FIXDTIRSDFHRKFLHRYMK 154 N + + S K+ W F N+++ E+ + + DT+ S H+KF+ +Y++ Sbjct: 166 NNSLTLQTHDSSTKKKSWRSSTTFNNKSKKESTNDRNNNYTTDTLNSQHHQKFMSKYIR 224
>IAR1_ARATH (Q9M647) IAA-alanine resistance protein 1| Length = 338 Score = 28.5 bits (62), Expect = 4.3 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = +1 Query: 136 KRTAASFHVPMQKLAVEITSDGVXDEPFRCLGLSTSLVLEY 258 ++T+AS EITSDG D+P + S+SLV Y Sbjct: 285 RKTSASDATDKSDSGTEITSDGKSDKPEQVETRSSSLVFGY 325
>YNX0_YEAST (P53861) Hypothetical 44.0 kDa protein in CSL4-URE2 intergenic| region Length = 379 Score = 27.7 bits (60), Expect = 7.4 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -1 Query: 297 GSFNVKRRWDDDVVFKNQARGETXTPKR 214 G FN+ +R V F QA G++ +PK+ Sbjct: 211 GGFNIAKRHAQRVAFGGQAGGQSSSPKK 238
>ZN683_HUMAN (Q8IZ20) Zinc finger protein 683| Length = 509 Score = 27.3 bits (59), Expect = 9.7 Identities = 13/43 (30%), Positives = 19/43 (44%) Frame = -3 Query: 235 RDXDTETVHXRHHQK*FPPQVSA*VHEMXLLYALCCMDSMHAG 107 R T+ +H + H + PQ VH L +L C+ H G Sbjct: 417 RSRFTQHIHLKLHHRLHAPQPCGLVHTQLPLASLACLAQWHQG 459
>CI084_HUMAN (Q5VXU9) Protein C9orf84| Length = 1444 Score = 27.3 bits (59), Expect = 9.7 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +1 Query: 223 CLGLSTSLVLEYNIIIPPSLDVE 291 CL +S ++EY +IPPSL E Sbjct: 169 CLNEPSSFLIEYEFLIPPSLKPE 191
>CWC15_YEAST (Q03772) Pre-mRNA-splicing factor CWC15 (Complexed with CEF1| protein 15) Length = 175 Score = 27.3 bits (59), Expect = 9.7 Identities = 16/69 (23%), Positives = 33/69 (47%), Gaps = 9/69 (13%) Frame = -1 Query: 333 MRGNPXINMNNSGSFNVKRRWDDDVVF-KNQARGETXTPKR--------FIXDTIRSDFH 181 + GN + NS +R W F +++ ET + +I D +S++H Sbjct: 111 LEGNEQLKGGNSS----RRSWRKGTAFGRHKVTKETNIKEHATKKSASGYINDMTKSEYH 166 Query: 180 RKFLHRYMK 154 ++FLH++++ Sbjct: 167 QEFLHKHVR 175 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,258,607 Number of Sequences: 219361 Number of extensions: 771854 Number of successful extensions: 1413 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1398 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1408 length of database: 80,573,946 effective HSP length: 88 effective length of database: 61,270,178 effective search space used: 1470484272 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)