| Clone Name | rbags5i08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TRPM7_MOUSE (Q923J1) Transient receptor potential cation channel... | 29 | 4.7 | 2 | TRPM7_HUMAN (Q96QT4) Transient receptor potential cation channel... | 29 | 6.2 | 3 | RNF38_HUMAN (Q9H0F5) RING finger protein 38 | 28 | 8.1 | 4 | RNF38_MOUSE (Q8BI21) RING finger protein 38 | 28 | 8.1 |
|---|
>TRPM7_MOUSE (Q923J1) Transient receptor potential cation channel subfamily M| member 7 (EC 2.7.11.1) (Long transient receptor potential channel 7) (LTrpC7) (Channel-kinase 1) (Transient receptor potential-phospholipase C-interacting kinase) (TRP-PLIK) Length = 1863 Score = 29.3 bits (64), Expect = 4.7 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +2 Query: 14 SYTITYTEIKQRVLFNRSIEEWPYNLHTTNTDDD 115 S + Y+++K FN++IEEW HT + D Sbjct: 57 SLAMKYSDVKLGEHFNQAIEEWSVEKHTEQSPTD 90
>TRPM7_HUMAN (Q96QT4) Transient receptor potential cation channel subfamily M| member 7 (EC 2.7.11.1) (Long transient receptor potential channel 7) (LTrpC7) (Channel-kinase 1) Length = 1865 Score = 28.9 bits (63), Expect = 6.2 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +2 Query: 14 SYTITYTEIKQRVLFNRSIEEWPYNLHTTNTDDD 115 S + Y+++K FN++IEEW HT + D Sbjct: 57 SLAMKYSDVKLGDHFNQAIEEWSVEKHTEQSPTD 90
>RNF38_HUMAN (Q9H0F5) RING finger protein 38| Length = 515 Score = 28.5 bits (62), Expect = 8.1 Identities = 20/52 (38%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Frame = +1 Query: 265 IDGDACQIHAPAARPCNPVLLGRPGAIV-FFLAVSGGLGRRREGEMQLLGNH 417 I D IH P P +P L PG V F S +R E E++LLG H Sbjct: 267 ISSDPFLIHPPHLSPHHPPHLPPPGQFVPFQTQQSRSPLQRIENEVELLGEH 318
>RNF38_MOUSE (Q8BI21) RING finger protein 38| Length = 518 Score = 28.5 bits (62), Expect = 8.1 Identities = 20/52 (38%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Frame = +1 Query: 265 IDGDACQIHAPAARPCNPVLLGRPGAIV-FFLAVSGGLGRRREGEMQLLGNH 417 I D IH P P +P L PG V F S +R E E++LLG H Sbjct: 270 ISSDPFLIHPPHLSPHHPPHLPPPGQFVPFQTQQSRSPLQRIENEVELLGEH 321 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,629,139 Number of Sequences: 219361 Number of extensions: 988988 Number of successful extensions: 2826 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2779 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2826 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2735358828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)