| Clone Name | rbags5i02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | EXOC5_MOUSE (Q3TPX4) Exocyst complex component 5 (Exocyst comple... | 28 | 8.4 | 2 | TR13B_HUMAN (O14836) Tumor necrosis factor receptor superfamily ... | 28 | 8.4 |
|---|
>EXOC5_MOUSE (Q3TPX4) Exocyst complex component 5 (Exocyst complex component| Sec10) Length = 708 Score = 28.5 bits (62), Expect = 8.4 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Frame = -1 Query: 289 VLVYLFVRLGGLYTRRLSPLDASCEGNLF-ICLRAAVSKCSKDVQHTLILY 140 VL+ L VR L L SC G++ IC A KC+KD + ++L+ Sbjct: 602 VLMELGVRFHRLIYEHLQQYSYSCMGDMLAICDVAEYRKCAKDFKIPMVLH 652
>TR13B_HUMAN (O14836) Tumor necrosis factor receptor superfamily member 13B| (Transmembrane activator and CAML interactor) (CD267 antigen) Length = 293 Score = 28.5 bits (62), Expect = 8.4 Identities = 25/82 (30%), Positives = 31/82 (37%), Gaps = 10/82 (12%) Frame = +1 Query: 64 RKAPEHCTKRPLSFFSLSCHEYVTHNIESTCAAHL*SIC*QLHAGK*KDCLHR------- 222 R PE PL +SC H + TCAA S+ + GK D L R Sbjct: 32 RSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCAS 91 Query: 223 ---TRPKGKASSCTNLLISQID 279 PK A C N L S ++ Sbjct: 92 ICGQHPKQCAYFCENKLRSPVN 113 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64,656,358 Number of Sequences: 219361 Number of extensions: 1300368 Number of successful extensions: 3364 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3303 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3363 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2851757076 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)