| Clone Name | rbags5h14 |
|---|---|
| Clone Library Name | barley_pub |
>RHSB_ECOLI (P16917) Protein rhsB precursor| Length = 1411 Score = 29.6 bits (65), Expect = 4.1 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +1 Query: 121 GTRMPGPNKHPDSLYKFWP 177 G R+P P HPDS WP Sbjct: 907 GNRLPDPELHPDSTLSMWP 925
>RHSC_ECOLI (P16918) Protein rhsC precursor| Length = 1397 Score = 29.6 bits (65), Expect = 4.1 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +1 Query: 121 GTRMPGPNKHPDSLYKFWP 177 G R+P P HPDS WP Sbjct: 907 GNRLPDPELHPDSALSMWP 925
>RHSA_ECOLI (P16916) Protein rhsA precursor| Length = 1377 Score = 29.6 bits (65), Expect = 4.1 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +1 Query: 121 GTRMPGPNKHPDSLYKFWP 177 G R+P P HPDS WP Sbjct: 907 GNRLPDPELHPDSTLSMWP 925
>BSN_MOUSE (O88737) Bassoon protein| Length = 3941 Score = 29.3 bits (64), Expect = 5.3 Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 2/34 (5%) Frame = +3 Query: 180 GHCIAPTPMPTV--TPGPSQISAKMGRLKAQQRS 275 GH APTPMPT P P Q ++ K +Q S Sbjct: 3124 GHYAAPTPMPTTQSAPFPVQADSRAAHQKPRQTS 3157
>SYR_BORPA (Q7W2Q2) Arginyl-tRNA synthetase (EC 6.1.1.19) (Arginine--tRNA| ligase) (ArgRS) Length = 561 Score = 29.3 bits (64), Expect = 5.3 Identities = 23/76 (30%), Positives = 30/76 (39%), Gaps = 10/76 (13%) Frame = +3 Query: 90 LCYLYSGS-----HPWHQNAWAEQASRLTIQILARGHCIAPTPMPTVTPGPS-----QIS 239 +C LY S ++ N Q L I + ARG IAP T G +I+ Sbjct: 149 ICRLYDASGWDVTREFYYNDAGNQIDNLAISVQARGRGIAPDAPDYPTDGYKGDYIVEIA 208 Query: 240 AKMGRLKAQQRSQGQP 287 K+ Q S GQP Sbjct: 209 RDFAARKSVQASDGQP 224
>RHSD_ECOLI (P16919) Protein rhsD precursor| Length = 1426 Score = 28.9 bits (63), Expect = 6.9 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +1 Query: 121 GTRMPGPNKHPDSLYKFWP 177 G R+P P HPDS WP Sbjct: 918 GNRLPDPELHPDSTLTVWP 936
>BTD_DROME (Q24266) Transcription factor btd (Protein buttonhead)| Length = 644 Score = 28.9 bits (63), Expect = 6.9 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = +3 Query: 45 RNEYSI-YPAKWQDCILCYLYSGSHPWHQNAWA 140 ++EY+ YPA + Y Y HP H NAWA Sbjct: 603 KSEYAASYPADFGAGTASYGYPHPHPHHHNAWA 635
>GA2L2_HUMAN (Q8NHY3) GAS2-like protein 2 (Growth arrest-specific 2-like 2)| (GAS2-related protein on chromosome 17) (GAR17 protein) Length = 880 Score = 28.9 bits (63), Expect = 6.9 Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 2/31 (6%) Frame = +3 Query: 192 APT--PMPTVTPGPSQISAKMGRLKAQQRSQ 278 APT P P VTPGP + K+G ++ R++ Sbjct: 676 APTGSPKPAVTPGPGSLKGKLGARQSGPRTK 706
>RHSE_ECOLI (P24211) Protein rhsE| Length = 682 Score = 28.9 bits (63), Expect = 6.9 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +1 Query: 121 GTRMPGPNKHPDSLYKFWP 177 G R+P P HPDS WP Sbjct: 193 GNRLPDPELHPDSTLTVWP 211
>SET2_CAEEL (Q18221) Protein set-2| Length = 1507 Score = 28.9 bits (63), Expect = 6.9 Identities = 19/65 (29%), Positives = 28/65 (43%), Gaps = 4/65 (6%) Frame = +3 Query: 111 SHPWHQ----NAWAEQASRLTIQILARGHCIAPTPMPTVTPGPSQISAKMGRLKAQQRSQ 278 SHP HQ +A A ++ + +R +APTP TV+ S SA ++ S Sbjct: 856 SHPKHQEHHHHAKASVSTPVHSSSTSRNSSVAPTPQRTVSTSSSSSSAATSARVSEDESD 915 Query: 279 GQPPP 293 P Sbjct: 916 SDSTP 920
>HR78_DROME (Q24142) Nuclear hormone receptor HR78 (dHR78) (Nuclear receptor| XR78E/F) Length = 601 Score = 28.9 bits (63), Expect = 6.9 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 3/45 (6%) Frame = -2 Query: 223 PGVTVGIGVGAMQWPLARICIVSLDACSAQ---AFWCHGCEPLYR 98 PG VG+G GA +C+V D S + A C GC+ ++ Sbjct: 33 PGGGVGMGAGASATLSVELCLVCGDRASGRHYGAISCEGCKGFFK 77
>BAG3_MOUSE (Q9JLV1) BAG family molecular chaperone regulator 3 (BCL-2-binding| athanogene-3) (BAG-3) (Bcl-2-binding protein Bis) Length = 577 Score = 28.5 bits (62), Expect = 9.1 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +3 Query: 192 APTPMPTVTPGPSQISAKMGRLKAQQRSQGQPPP 293 AP P P+ +P PS + + + A+Q++ P P Sbjct: 374 APIPCPSPSPAPSAVPSPPKNVAAEQKAAPSPAP 407
>GPNMB_RAT (Q6P7C7) Transmembrane glycoprotein NMB precursor| Length = 572 Score = 28.5 bits (62), Expect = 9.1 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +3 Query: 156 LTIQILARGHCIAPTPMPTVTPGPSQISA 242 LT+Q G C +PTP P+ + PS S+ Sbjct: 313 LTVQTAVPGPCPSPTPSPSSSTSPSPASS 341
>BSN_RAT (O88778) Bassoon protein| Length = 3937 Score = 28.5 bits (62), Expect = 9.1 Identities = 22/75 (29%), Positives = 27/75 (36%), Gaps = 5/75 (6%) Frame = +3 Query: 180 GHCIAPTPMPTV--TPGPSQISAKMGRLKAQQRSQG---QPPPER*EVVXXXXXXXXXXX 344 GH APTPMPT P P Q + K +Q S Q P EV+ Sbjct: 3109 GHYAAPTPMPTTQSAPFPVQADSHAAHQKPRQTSLADLEQKVPTNYEVISSPAVTVSSTP 3168 Query: 345 XXXXXXGVARAFLFE 389 G A + +E Sbjct: 3169 SETGYSGPAVSSSYE 3183 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,761,179 Number of Sequences: 219361 Number of extensions: 1291468 Number of successful extensions: 5216 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 4703 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5194 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3072927439 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)