| Clone Name | rbags5f24 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YD73_SCHPO (Q10328) Putative homeobox protein C32A11.03c in chro... | 32 | 1.1 | 2 | RENT1_DROME (Q9VYS3) Regulator of nonsense transcripts 1 homolog | 30 | 4.1 | 3 | SAHH_XYLFT (Q87EI8) Adenosylhomocysteinase (EC 3.3.1.1) (S-adeno... | 28 | 9.2 | 4 | SAHH_XYLFA (Q9PEJ1) Adenosylhomocysteinase (EC 3.3.1.1) (S-adeno... | 28 | 9.2 |
|---|
>YD73_SCHPO (Q10328) Putative homeobox protein C32A11.03c in chromosome I| Length = 942 Score = 31.6 bits (70), Expect = 1.1 Identities = 21/64 (32%), Positives = 33/64 (51%), Gaps = 1/64 (1%) Frame = +3 Query: 48 PCSSPTLWGLAR*ERKKVATVTEKENSKRAA-ERRRLSHLDDCLWALSASRMLSTHPSSP 224 P S T+W R + K+ + ++E +R E+R L L+ + A +LST P+SP Sbjct: 206 PERSVTIWFQNRRAKSKLISRRQEEERQRILREQRELDSLNQKVSQAFAHEVLSTSPTSP 265 Query: 225 GVAG 236 V G Sbjct: 266 YVGG 269
>RENT1_DROME (Q9VYS3) Regulator of nonsense transcripts 1 homolog| Length = 1180 Score = 29.6 bits (65), Expect = 4.1 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = -3 Query: 141 RQLSLNFPSRLPWQPSFFLISLGPKVSETSTAGLIDRPAAA 19 R+L L+FP P +P FFL++ G + S ++R AA Sbjct: 711 RRLKLDFPWPQPERPMFFLVTQGQEEIAGSGTSFLNRTEAA 751
>SAHH_XYLFT (Q87EI8) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 480 Score = 28.5 bits (62), Expect = 9.2 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +2 Query: 2 HLLQEAAAAGRSISPAVLVSDTLGPSEMRKKEGC 103 H L + AA GR + PA+ V+D++ S+ GC Sbjct: 209 HRLYQIAATGRLLVPAINVNDSVTKSKFDNLYGC 242
>SAHH_XYLFA (Q9PEJ1) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 480 Score = 28.5 bits (62), Expect = 9.2 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +2 Query: 2 HLLQEAAAAGRSISPAVLVSDTLGPSEMRKKEGC 103 H L + AA GR + PA+ V+D++ S+ GC Sbjct: 209 HRLYQIAATGRLLVPAINVNDSVTKSKFDNLYGC 242 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,136,970 Number of Sequences: 219361 Number of extensions: 1003188 Number of successful extensions: 2867 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2830 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2867 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3130907202 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)