| Clone Name | rbags5f10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CADH1_HUMAN (P12830) Epithelial-cadherin precursor (E-cadherin) ... | 30 | 2.0 | 2 | TALA_DICDI (P54633) Filopodin (Talin homolog) | 30 | 2.0 |
|---|
>CADH1_HUMAN (P12830) Epithelial-cadherin precursor (E-cadherin) (Uvomorulin)| (Cadherin-1) (CAM 120/80) (CD324 antigen) [Contains: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3] Length = 882 Score = 30.4 bits (67), Expect = 2.0 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = -2 Query: 100 ISSWVPHIPEPASDGADVHTYSFNLCKKKMHTG 2 +SSW+ PEP G D +Y+F + ++ + G Sbjct: 17 VSSWLCQEPEPCHPGFDAESYTFTVPRRHLERG 49
>TALA_DICDI (P54633) Filopodin (Talin homolog)| Length = 2492 Score = 30.4 bits (67), Expect = 2.0 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Frame = +2 Query: 260 SXSSSATAKGYSSCGRSAPGTSTNLVTPLAPLXASISALDLL-GEFXVXTTKTGTSPSN 433 S ++S++ GY + G A + P+ L +++ A DLL GE + TG +P N Sbjct: 391 SVANSSSYMGYGAGGGGANQLQPSQQIPITDLKSALRATDLLIGELGGFRSSTGATPQN 449 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,640,667 Number of Sequences: 219361 Number of extensions: 1159084 Number of successful extensions: 3216 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3145 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3212 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2628831825 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)