| Clone Name | rbags4o20 |
|---|---|
| Clone Library Name | barley_pub |
>STAG2_MOUSE (O35638) Cohesin subunit SA-2 (Stromal antigen 2) (SCC3 homolog 2)| Length = 1231 Score = 32.3 bits (72), Expect = 0.85 Identities = 22/62 (35%), Positives = 33/62 (53%) Frame = -3 Query: 525 RAEKPELLTVILPQSLKKQPPESQELLSKVQNLIEKPQYDHLPLIEASRLCNMDIISKVQ 346 R EL V LPQ L K +++ KV NL++ PQY L + RL N D+ + ++ Sbjct: 560 RTRITELFAVALPQLLAKYSVDAE----KVTNLLQLPQYFDLEIYTTGRLEN-DLDALLR 614 Query: 345 QV 340 Q+ Sbjct: 615 QI 616
>STAG2_HUMAN (Q8N3U4) Cohesin subunit SA-2 (Stromal antigen 2) (SCC3 homolog 2)| Length = 1231 Score = 31.2 bits (69), Expect = 1.9 Identities = 19/50 (38%), Positives = 26/50 (52%) Frame = -3 Query: 525 RAEKPELLTVILPQSLKKQPPESQELLSKVQNLIEKPQYDHLPLIEASRL 376 R + EL V LPQ L K +++ KV NL++ PQY L + RL Sbjct: 560 RTKITELFAVALPQLLAKYSVDAE----KVTNLLQLPQYFDLEIYTTGRL 605
>STAG2_XENLA (Q9DGN0) Cohesin subunit SA-2 (xSA-2) (Stromal antigen 2 homolog)| (SCC3 homolog 2) Length = 1194 Score = 30.0 bits (66), Expect = 4.2 Identities = 18/45 (40%), Positives = 24/45 (53%) Frame = -3 Query: 510 ELLTVILPQSLKKQPPESQELLSKVQNLIEKPQYDHLPLIEASRL 376 EL V LPQ L K +++ KV NL++ PQY L + RL Sbjct: 496 ELFAVSLPQLLAKYSVDAE----KVTNLLQLPQYFDLEIYTTGRL 536
>EX7S_METCA (Q60AM9) Probable exodeoxyribonuclease VII small subunit (EC| 3.1.11.6) (Exonuclease VII small subunit) Length = 76 Score = 30.0 bits (66), Expect = 4.2 Identities = 11/35 (31%), Positives = 25/35 (71%) Frame = -3 Query: 480 LKKQPPESQELLSKVQNLIEKPQYDHLPLIEASRL 376 + ++PP +E L++++ L+E+ + +LPL E+ +L Sbjct: 1 MARKPPSFEEALTELEQLVERMEQGNLPLEESLKL 35
>CTPE_MYCTU (P0A504) Probable cation-transporting ATPase E (EC 3.6.3.-)| Length = 797 Score = 29.6 bits (65), Expect = 5.5 Identities = 18/36 (50%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = -2 Query: 262 ALLLGLASTSGRFYPLFVRRPVNGML-FGLVIPVYT 158 A +L LA + R YP FVRR + + FGLVI V T Sbjct: 647 AFILSLAPNNERAYPGFVRRVMTSAVPFGLVIGVAT 682
>CTPE_MYCBO (P0A505) Probable cation-transporting ATPase E (EC 3.6.3.-)| Length = 797 Score = 29.6 bits (65), Expect = 5.5 Identities = 18/36 (50%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = -2 Query: 262 ALLLGLASTSGRFYPLFVRRPVNGML-FGLVIPVYT 158 A +L LA + R YP FVRR + + FGLVI V T Sbjct: 647 AFILSLAPNNERAYPGFVRRVMTSAVPFGLVIGVAT 682
>T3JAM_MOUSE (Q8C0G2) TRAF3-interacting JNK-activating modulator| (TRAF3-interacting protein 3) Length = 513 Score = 28.9 bits (63), Expect = 9.3 Identities = 18/43 (41%), Positives = 20/43 (46%) Frame = -3 Query: 492 LPQSLKKQPPESQELLSKVQNLIEKPQYDHLPLIEASRLCNMD 364 L LKK E Q L+SKVQ L Q L L E +L D Sbjct: 396 LQDQLKKSEEEKQALVSKVQQLQSLLQNQSLQLQEQEKLLKKD 438
>TRPM7_HUMAN (Q96QT4) Transient receptor potential cation channel subfamily M| member 7 (EC 2.7.11.1) (Long transient receptor potential channel 7) (LTrpC7) (Channel-kinase 1) Length = 1865 Score = 28.9 bits (63), Expect = 9.3 Identities = 20/89 (22%), Positives = 41/89 (46%), Gaps = 3/89 (3%) Frame = -3 Query: 507 LLTVILPQSLKKQPPESQELLSKVQNLIEKPQYDHLPLIEASRL---CNMDIISKVQQVI 337 +LTV+ + L++ PP + + Y H E L DIIS +++ Sbjct: 297 ILTVL--EYLQESPPVPVVVCEGTGRAADLLAYIHKQTEEGGNLPDAAEPDIISTIKKTF 354 Query: 336 CFAFHDSRLLMETCQEAKNMRKIVTLFYL 250 F +++ L +T E ++++T+F++ Sbjct: 355 NFGQNEALHLFQTLMECMKRKELITVFHI 383 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 71,914,852 Number of Sequences: 219361 Number of extensions: 1448464 Number of successful extensions: 3584 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 3371 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3583 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4142954952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)