| Clone Name | rbags5d19 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DCHS_DROME (Q05733) Histidine decarboxylase (EC 4.1.1.22) (HDC) | 28 | 6.4 | 2 | MUC15_MOUSE (Q8C6Z1) Mucin-15 precursor | 28 | 8.4 |
|---|
>DCHS_DROME (Q05733) Histidine decarboxylase (EC 4.1.1.22) (HDC)| Length = 847 Score = 28.1 bits (61), Expect = 6.4 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = +3 Query: 21 HLHSSSSRSRACALQTHQQMHVLLLHLSKNNPNSS 125 H HS S+ SR+C+ +H +H L++++P SS Sbjct: 631 HAHSLSTPSRSCSSSSHSLIH----SLTQSSPRSS 661
>MUC15_MOUSE (Q8C6Z1) Mucin-15 precursor| Length = 331 Score = 27.7 bits (60), Expect = 8.4 Identities = 23/78 (29%), Positives = 32/78 (41%), Gaps = 10/78 (12%) Frame = -3 Query: 207 WLLYSSAYQLRPSTA*IYDRVVTGFTGSCCLDCFWRDA----VVAHA------SADEFVE 58 WL+ SS+ RPS+ +V GF L+ DA V H+ S + F Sbjct: 89 WLMTSSSESSRPSSTYSVPPLVQGFVSKLPLNSSTADANPLQVSEHSNSTNSPSPENFTW 148 Query: 57 RMHESEKNYYEDVRTXVR 4 + N ED+ T VR Sbjct: 149 SLDNDTMNSPEDISTTVR 166 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,385,865 Number of Sequences: 219361 Number of extensions: 521231 Number of successful extensions: 1498 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1490 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1498 length of database: 80,573,946 effective HSP length: 51 effective length of database: 69,386,535 effective search space used: 1665276840 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)