| Clone Name | rbags5d04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GP110_HUMAN (Q5T601) Probable G-protein coupled receptor 110 pre... | 32 | 1.5 | 2 | DPOG2_HUMAN (Q9UHN1) DNA polymerase gamma subunit 2, mitochondri... | 31 | 2.5 |
|---|
>GP110_HUMAN (Q5T601) Probable G-protein coupled receptor 110 precursor| (G-protein coupled receptor PGR19) (G-protein coupled receptor KPG_012) Length = 911 Score = 32.0 bits (71), Expect = 1.5 Identities = 17/45 (37%), Positives = 24/45 (53%) Frame = -1 Query: 552 QVTCYPTTTMATGYLLRGSSKLSDLRAKAEKFCGSPRTELSKLFP 418 QVT + ++ GY + GSS S+L + E +T L KLFP Sbjct: 200 QVTQFRNGSIVAGYEVVGSSSASELLSAIEHVAEKAKTALHKLFP 244
>DPOG2_HUMAN (Q9UHN1) DNA polymerase gamma subunit 2, mitochondrial precursor| (EC 2.7.7.7) (Mitochondrial DNA polymerase accessory subunit) (PolG-beta) (MtPolB) (DNA polymerase gamma accessory 55 kDa subunit) (p55) Length = 485 Score = 31.2 bits (69), Expect = 2.5 Identities = 19/57 (33%), Positives = 32/57 (56%) Frame = +3 Query: 312 HPTYLPAGI*AYVQVKPSRQDLSVSRWSAPLLVMFREKAWRALSAVIHKTSPLLPSD 482 HP + P G+ R++L+ W++ +V+FRE+ + + A+ HK PLLP D Sbjct: 96 HPGFGPLGV-------ELRKNLAAEWWTS--VVVFREQVF-PVDALHHKPGPLLPGD 142 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 90,471,051 Number of Sequences: 219361 Number of extensions: 1953876 Number of successful extensions: 5005 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4779 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4993 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5481822624 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)