| Clone Name | rbags5c12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y829_SYNY3 (Q55423) Putative methyltransferase sll0829 (EC 2.1.1.-) | 33 | 0.66 | 2 | GR43B_DROME (Q9V4Q0) Putative chemosensory receptor 43b | 33 | 1.1 |
|---|
>Y829_SYNY3 (Q55423) Putative methyltransferase sll0829 (EC 2.1.1.-)| Length = 212 Score = 33.5 bits (75), Expect = 0.66 Identities = 25/63 (39%), Positives = 33/63 (52%) Frame = -2 Query: 539 HTSYALHQGLYCLVQLIYLMMVKVLRYFLTIALHALHRYSTFVNWELWWPQFPILVYFKE 360 HTS ALH+ +Q I + +VL+ AL LHR S NW L+WP I + E Sbjct: 111 HTSVALHEMTPAQLQSIISGVHRVLKPGGIFALVDLHRPS---NW-LFWPPLAIFMGLFE 166 Query: 359 TQT 351 T+T Sbjct: 167 TET 169
>GR43B_DROME (Q9V4Q0) Putative chemosensory receptor 43b| Length = 430 Score = 32.7 bits (73), Expect = 1.1 Identities = 20/55 (36%), Positives = 32/55 (58%), Gaps = 4/55 (7%) Frame = -2 Query: 584 QVRTYLLVARTVGSKHTSYALHQGLYCLVQLIYLMMV----KVLRYFLTIALHAL 432 +VR +LL+A + ++HTS +HQ L L +I L + V+ Y +T+ L AL Sbjct: 356 KVRPHLLIAMVLENEHTSLIIHQKLKPLENMIILDITCDREFVMDYIVTVILTAL 410 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 107,164,668 Number of Sequences: 219361 Number of extensions: 2306285 Number of successful extensions: 5594 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5358 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5594 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7252940416 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)