| Clone Name | rbags4n01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TBX8_CAEEL (Q22292) T-box transcription factor tbx-8 | 32 | 0.47 | 2 | CYB_PSEAU (Q9MLK4) Cytochrome b | 28 | 5.2 |
|---|
>TBX8_CAEEL (Q22292) T-box transcription factor tbx-8| Length = 315 Score = 32.0 bits (71), Expect = 0.47 Identities = 13/45 (28%), Positives = 22/45 (48%) Frame = +2 Query: 38 WMKHGTSLHSRDARLLTYRDGILSSQMIKQNPCCYTNIXALYCKE 172 W+K G + R+ + L + DG+ S + NP C+ + C E Sbjct: 74 WVKSGKAEKHREPKKLWHADGVRSGKEWMTNPVCFDRVKITNCAE 118
>CYB_PSEAU (Q9MLK4) Cytochrome b| Length = 372 Score = 28.5 bits (62), Expect = 5.2 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = -2 Query: 130 VLLYHLAGKNAIPVSEKPSVSTV*GCSMFHPYHSY*CLFSCT 5 ++L H G N P+ P + + FHPYHSY +F T Sbjct: 189 IMLLHNEGSNN-PLGTNPDIDKI----PFHPYHSYKDMFIIT 225 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,223,295 Number of Sequences: 219361 Number of extensions: 336179 Number of successful extensions: 883 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 883 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 883 length of database: 80,573,946 effective HSP length: 34 effective length of database: 73,115,672 effective search space used: 1754776128 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)