| Clone Name | rbags4j09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HRPX_PLALO (P04929) Histidine-rich glycoprotein precursor | 30 | 2.5 | 2 | MYSS_CYPCA (Q90339) Myosin heavy chain, fast skeletal muscle | 29 | 7.3 | 3 | GLT1_YEAST (Q12680) Glutamate synthase [NADPH] precursor (EC 1.4... | 28 | 9.6 |
|---|
>HRPX_PLALO (P04929) Histidine-rich glycoprotein precursor| Length = 351 Score = 30.4 bits (67), Expect = 2.5 Identities = 26/125 (20%), Positives = 43/125 (34%), Gaps = 5/125 (4%) Frame = +1 Query: 52 SLTKSQPKV*SXILLSQLTTPISIRFKVAYDLPHHXHWXLLTQPHH-----H*TRTLSDP 216 SL K P+ S + ++ ++ + ++ HH H +PHH H +P Sbjct: 29 SLVKHIPQTGSNLTFDRVLVEDTVHPEHLHEEHHHHHPEEHHEPHHEEHHHHHPEEHHEP 88 Query: 217 H**AQRQFHH*KQTLSLXVGISPLDFYXAPLHCHIRLXPFQHXHISYLGLWKHLHQXGHH 396 H + HH + P H H P H H+ + H HH Sbjct: 89 H---HEEHHH---------------HHPHPHHHHHHHPPHHHHHLGHHHHHHHAAHHHHH 130 Query: 397 EDDEY 411 E+ + Sbjct: 131 EEHHH 135
>MYSS_CYPCA (Q90339) Myosin heavy chain, fast skeletal muscle| Length = 1935 Score = 28.9 bits (63), Expect = 7.3 Identities = 17/71 (23%), Positives = 35/71 (49%), Gaps = 1/71 (1%) Frame = -3 Query: 418 ERSTHHLHDVLXGEDASTTQDRICEXVEMEXAEYDNAMEXRRSLRVRYLHXVKEFVSND- 242 ERS H + ++ G + + E + + YD M + + V+ ++ V+EF++ D Sbjct: 282 ERSYHIFYQLMTGH-----KPELLEALLITTNPYDYPMISQGEITVKSINDVEEFIATDT 336 Query: 241 EIDVVPINEDQ 209 ID++ D+ Sbjct: 337 AIDILGFTADE 347
>GLT1_YEAST (Q12680) Glutamate synthase [NADPH] precursor (EC 1.4.1.13)| (NADPH-GOGAT) Length = 2144 Score = 28.5 bits (62), Expect = 9.6 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = -3 Query: 262 KEFVSNDEIDVVPINEDQIEFESNDDGVGLEXTNXNGEE 146 KEF+ NDE +V I ++E++ + GV N EE Sbjct: 1998 KEFIGNDEGEVTAIRTVRVEWKKSQSGVWQMVEIPNSEE 2036 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,611,184 Number of Sequences: 219361 Number of extensions: 747726 Number of successful extensions: 1642 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1592 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1631 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3246866728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)