| Clone Name | rbags4i20 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y114_CHLMU (Q9PLI5) Hypothetical protein TC0114 | 37 | 0.032 | 2 | ARODE_CHLMU (P56961) Shikimate biosynthesis protein aroDE [Inclu... | 29 | 8.6 |
|---|
>Y114_CHLMU (Q9PLI5) Hypothetical protein TC0114| Length = 122 Score = 37.4 bits (85), Expect = 0.032 Identities = 15/19 (78%), Positives = 18/19 (94%) Frame = +2 Query: 512 PASRTALMGEQPNPWNHLQ 568 P+SRTAL+GEQPNPW+ LQ Sbjct: 58 PSSRTALIGEQPNPWDLLQ 76 Score = 29.6 bits (65), Expect = 6.6 Identities = 17/37 (45%), Positives = 20/37 (54%), Gaps = 3/37 (8%) Frame = +1 Query: 469 PTPDMDRTVSRRSEPSFTYRINGRTAQP---LEPPTA 570 PT D D+TVSRR EPS + G P L+P A Sbjct: 44 PTKDRDQTVSRRFEPSSRTALIGEQPNPWDLLQPQDA 80
>ARODE_CHLMU (P56961) Shikimate biosynthesis protein aroDE [Includes:| 3-dehydroquinate dehydratase (EC 4.2.1.10) (3-dehydroquinase) (Type I DHQase); Shikimate dehydrogenase (EC 1.1.1.25)] Length = 478 Score = 29.3 bits (64), Expect = 8.6 Identities = 12/31 (38%), Positives = 21/31 (67%) Frame = +1 Query: 145 LHTSLHFHLTPI*TARLAATLSYFHTSVAPS 237 LHTS H +T + T LA+++ Y+ +V+P+ Sbjct: 109 LHTSEHTDITQLYTQMLASSIDYYKLAVSPA 139 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 88,175,880 Number of Sequences: 219361 Number of extensions: 1839375 Number of successful extensions: 4491 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4349 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4491 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4986986160 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)