| Clone Name | rbags4i15 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NAOX_MYCGE (Q49408) Probable NADH oxidase (EC 1.6.99.3) (NOXase) | 29 | 2.8 | 2 | NAOX_MYCPN (P75389) Probable NADH oxidase (EC 1.6.99.3) (NOXase) | 28 | 4.8 | 3 | XFIN_XENLA (P08045) Zinc finger protein Xfin | 28 | 6.2 | 4 | ZO1_HUMAN (Q07157) Tight junction protein ZO-1 (Zonula occludens... | 28 | 8.1 |
|---|
>NAOX_MYCGE (Q49408) Probable NADH oxidase (EC 1.6.99.3) (NOXase)| Length = 478 Score = 29.3 bits (64), Expect = 2.8 Identities = 15/48 (31%), Positives = 26/48 (54%) Frame = +3 Query: 24 EYRNTVX*N*RLKSTL*AKQHVSGMNKTELEMVIGTSLKPISSQNVSA 167 +Y N +KS L A H+ G N+ +L+ ++GT+ I N++A Sbjct: 316 QYENIDLATNAVKSGLVAAMHIIGSNQVKLQSIVGTNALHIFGLNLAA 363
>NAOX_MYCPN (P75389) Probable NADH oxidase (EC 1.6.99.3) (NOXase)| Length = 479 Score = 28.5 bits (62), Expect = 4.8 Identities = 16/57 (28%), Positives = 28/57 (49%) Frame = +3 Query: 24 EYRNTVX*N*RLKSTL*AKQHVSGMNKTELEMVIGTSLKPISSQNVSATKHNIRRTR 194 +Y N +KS L A H+ G +LE ++GT+ + N++AT +R + Sbjct: 316 QYENIDLATNAVKSGLVAAMHMIGSKAVKLESIVGTNALHVFGLNLAATGLTEKRAK 372
>XFIN_XENLA (P08045) Zinc finger protein Xfin| Length = 1350 Score = 28.1 bits (61), Expect = 6.2 Identities = 13/39 (33%), Positives = 24/39 (61%) Frame = +3 Query: 78 KQHVSGMNKTELEMVIGTSLKPISSQNVSATKHNIRRTR 194 ++H N L+ V+GT P+SSQNV+++ ++ + R Sbjct: 296 RKHTEFRNVLNLDSVVGTD--PLSSQNVASSPYSCSKCR 332
>ZO1_HUMAN (Q07157) Tight junction protein ZO-1 (Zonula occludens 1 protein)| (Zona occludens 1 protein) (Tight junction protein 1) Length = 1748 Score = 27.7 bits (60), Expect = 8.1 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = +1 Query: 151 HRMSQQPNITYDAQEMHLSKAPIHQISQP 237 HR ++PN+TY+ Q ++ K + QP Sbjct: 1029 HRPDKEPNLTYEPQLPYVEKQASRDLEQP 1057 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,305,535 Number of Sequences: 219361 Number of extensions: 440608 Number of successful extensions: 1034 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1029 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1034 length of database: 80,573,946 effective HSP length: 60 effective length of database: 67,412,286 effective search space used: 1617894864 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)