| Clone Name | rbags4g01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y5703_STRCO (Q9KYR2) UPF0090 protein SCO5703 | 30 | 3.3 |
|---|
>Y5703_STRCO (Q9KYR2) UPF0090 protein SCO5703| Length = 177 Score = 30.0 bits (66), Expect = 3.3 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = -1 Query: 318 TDRPSHHHLRSAGLLLIPVLVLEFDGVDLSIDRIRSHRVIAR 193 TDR LR G L+ +L ++ DG+DL + ++ R R Sbjct: 98 TDRLVRFQLREGGELVARILAVDEDGLDLEVPGVKGRRPTTR 139 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 73,025,490 Number of Sequences: 219361 Number of extensions: 1490208 Number of successful extensions: 3346 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3282 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3345 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3246866728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)