| Clone Name | rbags3p16 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | JAK3_MOUSE (Q62137) Tyrosine-protein kinase JAK3 (EC 2.7.10.2) (... | 31 | 2.4 | 2 | MRP3_HUMAN (O15438) Canalicular multispecific organic anion tran... | 30 | 4.1 | 3 | ECM30_YEAST (Q06673) Extracellular matrix protein 30 | 29 | 7.1 | 4 | LARGE_BRARE (Q66PG2) Glycosyltransferase-like protein LARGE1 (EC... | 29 | 9.2 |
|---|
>JAK3_MOUSE (Q62137) Tyrosine-protein kinase JAK3 (EC 2.7.10.2) (Janus kinase| 3) (JAK-3) Length = 1299 Score = 30.8 bits (68), Expect = 2.4 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = -2 Query: 432 TMYRLELSSMKVPWIVGECLR*RKTMYA*CTLVCISAGLWG 310 T+ LE+ + ++PW+ ECL+ +T+ C+ A WG Sbjct: 888 TVLSLEMLTDRIPWVAPECLQEAQTL-------CLEADKWG 921
>MRP3_HUMAN (O15438) Canalicular multispecific organic anion transporter 2| (Multidrug resistance-associated protein 3) (Multi-specific organic anion transporter-D) (MOAT-D) Length = 1527 Score = 30.0 bits (66), Expect = 4.1 Identities = 15/58 (25%), Positives = 29/58 (50%), Gaps = 4/58 (6%) Frame = -2 Query: 177 IYFVLPLTRNIRAIPSLIFLY----QGSTMDSLACLFWFLCVAGCYIYVLLPFQNSCL 16 ++FV PL + + + + + QG + +FWFLCV + ++PF++ L Sbjct: 104 VFFVTPLVVGVTMLLATLLIQYERLQGVQSSGVLIIFWFLCV----VCAIVPFRSKIL 157
>ECM30_YEAST (Q06673) Extracellular matrix protein 30| Length = 1274 Score = 29.3 bits (64), Expect = 7.1 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +1 Query: 1 YIDKSKTRILEWKEYINITSSHAKKPEKACKTVHSTPLVK 120 +ID S+ R + + N +SSHA P + H+ P K Sbjct: 399 HIDASRRRAVSTSSHDNSSSSHASLPSSSSAAYHTKPQTK 438
>LARGE_BRARE (Q66PG2) Glycosyltransferase-like protein LARGE1 (EC 2.4.-.-)| (Acetylglucosaminyltransferase-like 1A) Length = 757 Score = 28.9 bits (63), Expect = 9.2 Identities = 15/51 (29%), Positives = 26/51 (50%) Frame = +2 Query: 248 TLHKLENVRRILSGRQDKSAHPHSPAEIQTKVHHAYIVFLHLKHSPTIQGT 400 T H EN+++ LS D+ + + VH ++ FLH ++ PT+ T Sbjct: 424 TDHNSENLQKTLS-ELDEDDPCYEFRRERFTVHRTHVYFLHYEYEPTVDNT 473 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 74,570,498 Number of Sequences: 219361 Number of extensions: 1607870 Number of successful extensions: 3849 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3741 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3849 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4085413911 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)