| Clone Name | rbags3p07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | UL52_EHV1V (P84401) DNA helicase/primase complex protein | 31 | 3.5 | 2 | UL52_EHV1B (P28962) DNA helicase/primase complex protein (DNA re... | 31 | 3.5 |
|---|
>UL52_EHV1V (P84401) DNA helicase/primase complex protein| Length = 1081 Score = 30.8 bits (68), Expect = 3.5 Identities = 16/48 (33%), Positives = 26/48 (54%) Frame = -1 Query: 271 HLSLQGFRHGLLVXXXXXXXXXXXXXXYKYGCFFYRTSRPKKVEVRSL 128 HL+++GFR G+ + Y C+FY+TS P ++ VR+L Sbjct: 667 HLAMRGFRAGI-ITTLSLIFSDATVQWDSYPCYFYKTSCPPQL-VRAL 712
>UL52_EHV1B (P28962) DNA helicase/primase complex protein (DNA replication| protein UL52) Length = 1081 Score = 30.8 bits (68), Expect = 3.5 Identities = 16/48 (33%), Positives = 26/48 (54%) Frame = -1 Query: 271 HLSLQGFRHGLLVXXXXXXXXXXXXXXYKYGCFFYRTSRPKKVEVRSL 128 HL+++GFR G+ + Y C+FY+TS P ++ VR+L Sbjct: 667 HLAMRGFRAGI-ITTLSLIFSDATVQWDSYPCYFYKTSCPPQL-VRAL 712 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,826,702 Number of Sequences: 219361 Number of extensions: 1275966 Number of successful extensions: 3010 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2965 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3008 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 5972710590 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)