| Clone Name | rbags4d24 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FTSKL_DEIRA (Q9RXB5) Hypothetical ftsK-like protein DR0400 | 33 | 0.93 |
|---|
>FTSKL_DEIRA (Q9RXB5) Hypothetical ftsK-like protein DR0400| Length = 980 Score = 32.7 bits (73), Expect = 0.93 Identities = 17/57 (29%), Positives = 32/57 (56%) Frame = +2 Query: 299 ASL*INQTSQHVISKI*SVCPKSKQVESRRCFTSCPVQRETVDDVETPKDEREMSLR 469 AS + +H++++I S+ K+K++E+ RC ++R TV+ V+ D LR Sbjct: 80 ASAALENVRRHLVNQILSIGGKAKKLETERCAAERHLKRPTVEVVQREHDAHLRRLR 136 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 87,150,050 Number of Sequences: 219361 Number of extensions: 1649394 Number of successful extensions: 3186 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3111 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3186 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 5972710590 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)