| Clone Name | rbags4d21 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TMM15_HUMAN (Q9UPQ8) Transmembrane protein 15 | 28 | 5.0 | 2 | LMP1_EBVR (P13198) Latent membrane protein 1 (LMP-1) (Protein p63) | 28 | 6.5 | 3 | LMP1_EBVC (P29362) Latent membrane protein 1 (LMP-1) (Protein p63) | 28 | 6.5 |
|---|
>TMM15_HUMAN (Q9UPQ8) Transmembrane protein 15| Length = 538 Score = 28.5 bits (62), Expect = 5.0 Identities = 19/63 (30%), Positives = 33/63 (52%), Gaps = 9/63 (14%) Frame = +1 Query: 49 W*HRYTRVQANPLN-MTKFITKTS--------WNPLPSLACMINSETSIKQNADKSWNHG 201 W HR R NPL + +F+ +T W+ L +LAC++ + K+++ +S H Sbjct: 274 WLHRLIR--RNPLLWLLQFLFQTDTRIYLLAYWSLLATLACLVVLYQNAKRSSSESKKHQ 331 Query: 202 SPT 210 +PT Sbjct: 332 APT 334
>LMP1_EBVR (P13198) Latent membrane protein 1 (LMP-1) (Protein p63)| Length = 386 Score = 28.1 bits (61), Expect = 6.5 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -2 Query: 214 AAWGSHGSKIYLHFVLWTFHCL 149 A W HG +YL VL+ F CL Sbjct: 96 ALWNLHGQALYLGIVLFIFGCL 117
>LMP1_EBVC (P29362) Latent membrane protein 1 (LMP-1) (Protein p63)| Length = 404 Score = 28.1 bits (61), Expect = 6.5 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -2 Query: 214 AAWGSHGSKIYLHFVLWTFHCL 149 A W HG +YL VL+ F CL Sbjct: 96 ALWNLHGQALYLGIVLFIFGCL 117 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,200,446 Number of Sequences: 219361 Number of extensions: 582850 Number of successful extensions: 1305 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1286 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1305 length of database: 80,573,946 effective HSP length: 47 effective length of database: 70,263,979 effective search space used: 1686335496 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)