| Clone Name | rbags4d19 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PHR_THET8 (P61497) Deoxyribodipyrimidine photo-lyase (EC 4.1.99.... | 30 | 4.7 | 2 | DISC_DROME (P23792) Protein disconnected | 30 | 4.7 | 3 | TRMA_VIBVY (Q7MQ79) tRNA (uracil-5-)-methyltransferase (EC 2.1.1... | 30 | 8.0 | 4 | TRMA_VIBVU (Q8DD43) tRNA (uracil-5-)-methyltransferase (EC 2.1.1... | 30 | 8.0 |
|---|
>PHR_THET8 (P61497) Deoxyribodipyrimidine photo-lyase (EC 4.1.99.3) (DNA| photolyase) (Photoreactivating enzyme) Length = 420 Score = 30.4 bits (67), Expect = 4.7 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = -1 Query: 500 RNIVPALPAVEAYYKGLKEREIPSDDPRL 414 R P LP EA KG +E EIP +DP L Sbjct: 144 RGAAPPLPPPEALPKGPEEGEIPREDPGL 172
>DISC_DROME (P23792) Protein disconnected| Length = 568 Score = 30.4 bits (67), Expect = 4.7 Identities = 22/80 (27%), Positives = 33/80 (41%), Gaps = 2/80 (2%) Frame = +1 Query: 223 RPKRVGYLVFWRLNILVHPATSPK--QFSTCIGSARDQSTLTVHY*VFLLGPNRSCRLSK 396 +P+R G ++PAT K Q S C + D+ L +H+ L C + Sbjct: 67 KPRRWGSPPINLAGQFINPATGKKRVQCSICFKTFCDKGALKIHFSAVHLREMHKCTVEG 126 Query: 397 TRATFTSRGSSEGISRSFNP 456 F+SR S S + NP Sbjct: 127 CNMVFSSRRSRNRHSANPNP 146
>TRMA_VIBVY (Q7MQ79) tRNA (uracil-5-)-methyltransferase (EC 2.1.1.35)| (tRNA(M-5-U54)-methyltransferase) (RUMT) Length = 369 Score = 29.6 bits (65), Expect = 8.0 Identities = 17/50 (34%), Positives = 26/50 (52%) Frame = +2 Query: 449 SIPCSMLQQQEVLELYCGFEAYPRYNLQLYIHQSFHQKLLVEDPFPSWDS 598 ++ C+ Q ++LELYCG N L + Q+F + L E PS +S Sbjct: 203 AVDCTQESQGDLLELYCG-----NGNFSLALAQNFERVLATELAKPSVES 247
>TRMA_VIBVU (Q8DD43) tRNA (uracil-5-)-methyltransferase (EC 2.1.1.35)| (tRNA(M-5-U54)-methyltransferase) (RUMT) Length = 369 Score = 29.6 bits (65), Expect = 8.0 Identities = 17/50 (34%), Positives = 26/50 (52%) Frame = +2 Query: 449 SIPCSMLQQQEVLELYCGFEAYPRYNLQLYIHQSFHQKLLVEDPFPSWDS 598 ++ C+ Q ++LELYCG N L + Q+F + L E PS +S Sbjct: 203 AVDCTQESQGDLLELYCG-----NGNFSLALAQNFERVLATELAKPSVES 247 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 103,916,919 Number of Sequences: 219361 Number of extensions: 2393834 Number of successful extensions: 6289 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6076 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6287 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6086476506 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)