| Clone Name | rbags3o05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GCSP1_PSEAE (Q9I137) Glycine dehydrogenase [decarboxylating] 1 (... | 30 | 5.7 | 2 | ACDB1_METJA (Q57616) Acetyl-CoA decarbonylase/synthase complex b... | 30 | 7.5 | 3 | VSI5_TRYBB (P26330) Variant surface glycoprotein ILTAT 1.25 prec... | 30 | 9.7 |
|---|
>GCSP1_PSEAE (Q9I137) Glycine dehydrogenase [decarboxylating] 1 (EC 1.4.4.2)| (Glycine decarboxylase 1) (Glycine cleavage system P-protein 1) Length = 959 Score = 30.4 bits (67), Expect = 5.7 Identities = 20/72 (27%), Positives = 34/72 (47%), Gaps = 2/72 (2%) Frame = -3 Query: 685 VEKYGPEIIQRHLFEFCSQETNREALLKYAQTKVN--NLKEAGDARGENTLHDYMTLLDI 512 +E+ G + Q+H F+ S T +A+ + NL+E R +L + + D+ Sbjct: 379 LERLGVAVEQKHFFDTLSLATGARTAAIHAKARAAGINLREIDAGRLGLSLDETVRQTDV 438 Query: 511 EKAYALLAAEEQ 476 E + LLA E Q Sbjct: 439 ETLWGLLAEEGQ 450
>ACDB1_METJA (Q57616) Acetyl-CoA decarbonylase/synthase complex beta subunit 1| (EC 2.3.1.-) (ACDS complex beta subunit 1) (ACDS complex acyltransferase 1) Length = 748 Score = 30.0 bits (66), Expect = 7.5 Identities = 21/66 (31%), Positives = 33/66 (50%) Frame = -1 Query: 483 RSK*PMAQSLVGAVRMRIAVVETMPLQEMRLLRVLEVMHKVGVKVRLKTLLRKSVKGTIK 304 +S+ P + VG + I +PL E ++ +L V+ KVG K +LK L+ K I Sbjct: 104 KSEKPYKEPYVGFIPDEILRGLGVPLVEGKIPAILVVIGKVGDKEKLKKLIDDIKKRNIL 163 Query: 303 TMFGGD 286 + GD Sbjct: 164 ALLVGD 169
>VSI5_TRYBB (P26330) Variant surface glycoprotein ILTAT 1.25 precursor (VSG)| Length = 507 Score = 29.6 bits (65), Expect = 9.7 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = -3 Query: 511 EKAYALLAAEEQIANGPVTCGGSEDADRGS 422 EKA A L QI NG V C GSE +GS Sbjct: 292 EKAVAGLLGAAQINNGAVDCDGSEANGKGS 321 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 91,565,723 Number of Sequences: 219361 Number of extensions: 1733349 Number of successful extensions: 3459 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3413 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3458 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7366267610 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)