ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbags3n08 |
|---|---|
| Clone Library Name | barley_pub |
>AT8A1_MOUSE (P70704) Probable phospholipid-transporting ATPase IA (EC 3.6.3.1)| (Chromaffin granule ATPase II) (ATPase class I type 8A member 1) Length = 1149 Score = 32.3 bits (72), Expect = 0.90 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Frame = -2 Query: 420 FCGGVAGSIFCTRYSRLWDESAKGK-YYSHV*YGFLQNESFSFLVPCFLLSGL 265 FC +A S+ C+ S +W+ GK +Y H+ YG N +FL L + L Sbjct: 302 FCILIAMSLVCSVGSAIWNRRHSGKDWYLHLHYGGASNFGLNFLTFIILFNNL 354
>PQQE_RHOPA (Q6N8F3) Coenzyme PQQ synthesis protein E (Pyrroloquinoline quinone| biosynthesis protein E) Length = 377 Score = 31.6 bits (70), Expect = 1.5 Identities = 18/53 (33%), Positives = 27/53 (50%) Frame = -3 Query: 530 VVLLDFQNGEPTTKSDGVVELARSVVSIDYPEGELTVSVEASRDRFSARGTVG 372 V+ + F GEPT + D +VEL R + +T +V SR+R +A G Sbjct: 63 VLQVHFSGGEPTARKD-LVELVRHATEVGLYTNLITSAVLLSRERLAALADAG 114
>YRRI_BACSU (O34472) Hypothetical UPF0118 protein yrrI| Length = 353 Score = 30.8 bits (68), Expect = 2.6 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 3/51 (5%) Frame = -1 Query: 415 WRRRGIDFLHEVQSALG*KCQGEVLLARVIWFSAK*KFQFLG---PLFLAI 272 WR+RG FL +V +LG +G++L+ ++ A F G PL L + Sbjct: 197 WRKRGSAFLRDVDDSLGDYIRGQLLVCLILGVIAGISFWVFGLPYPLILGL 247
>NFIB_MOUSE (P97863) Nuclear factor 1 B-type (Nuclear factor 1/B) (NF1-B)| (NFI-B) (NF-I/B) (CCAAT-box-binding transcription factor) (CTF) (TGGCA-binding protein) Length = 570 Score = 30.8 bits (68), Expect = 2.6 Identities = 17/47 (36%), Positives = 23/47 (48%) Frame = +1 Query: 349 PLGTFIPKPTVPRAENRSRDASTETVSSPSG*SIETTLLASSTTPSD 489 P G F P P P A +R+ + +SSP+ L SST+P D Sbjct: 285 PTGDFYPSPNSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSTSPQD 331
>NFIB_MESAU (P13622) Nuclear factor 1 B-type (Nuclear factor 1/B) (NF1-B)| (NFI-B) (NF-I/B) (CCAAT-box-binding transcription factor) (CTF) (TGGCA-binding protein) Length = 561 Score = 30.8 bits (68), Expect = 2.6 Identities = 17/47 (36%), Positives = 23/47 (48%) Frame = +1 Query: 349 PLGTFIPKPTVPRAENRSRDASTETVSSPSG*SIETTLLASSTTPSD 489 P G F P P P A +R+ + +SSP+ L SST+P D Sbjct: 285 PTGDFYPSPNSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSTSPQD 331
>PTXBC_BACSU (P15400) PTS system sac EIIBC component (Negative regulatory| protein of sacY) [Includes: Phosphotransferase enzyme IIB component (EC 2.7.1.69) (PTS system EIIB component); Permease IIC component (PTS system EIIC component)] Length = 459 Score = 30.0 bits (66), Expect = 4.5 Identities = 17/64 (26%), Positives = 31/64 (48%), Gaps = 1/64 (1%) Frame = -2 Query: 312 NESFSFLVPCFLLSGLKSNLIXKXQPYPWFAQLSHWTIYVSILSCFG-TYLPVVLDYSCL 136 ++ F ++P SGL LI + + WFA S W + ++S LP+++ +S Sbjct: 109 SDIFVPIIPAITASGLLMGLIGMIKVFHWFAAGSPWIKMLDLVSSTAFILLPILVGFSAA 168 Query: 135 LRCG 124 + G Sbjct: 169 RQFG 172
>AT8A1_HUMAN (Q9Y2Q0) Probable phospholipid-transporting ATPase IA (EC 3.6.3.1)| (Chromaffin granule ATPase II) (ATPase class I type 8A member 1) Length = 1164 Score = 29.6 bits (65), Expect = 5.9 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Frame = -2 Query: 420 FCGGVAGSIFCTRYSRLWDESAKGK-YYSHV*YGFLQNESFSFLVPCFLLSGL 265 FC +A S+ C+ S +W+ GK +Y ++ YG N +FL L + L Sbjct: 302 FCILIAMSLVCSVGSAIWNRRHSGKDWYLNLNYGGASNFGLNFLTFIILFNNL 354
>GP154_MOUSE (Q8BZP8) Neuropeptide S receptor (G-protein coupled receptor 154)| (G-protein coupled receptor PGR14) Length = 371 Score = 29.6 bits (65), Expect = 5.9 Identities = 15/68 (22%), Positives = 36/68 (52%) Frame = -2 Query: 354 KGKYYSHV*YGFLQNESFSFLVPCFLLSGLKSNLIXKXQPYPWFAQLSHWTIYVSILSCF 175 +G+ + V G + SF F +P ++ G ++ + Q + + S+WT Y++I++ Sbjct: 158 QGEKQAKVLIGIAWSLSFLFSIPTLIIFGKRTLSNGEVQCWALWPDDSYWTPYMTIVAFL 217 Query: 174 GTYLPVVL 151 ++P+ + Sbjct: 218 VYFIPLAI 225
>ABP1_RIPCL (Q27905) Probable antibacterial peptide polyprotein| Length = 678 Score = 29.3 bits (64), Expect = 7.7 Identities = 15/29 (51%), Positives = 20/29 (68%), Gaps = 1/29 (3%) Frame = +1 Query: 355 GTFIPKPTVPRAENRS-RDASTETVSSPS 438 G ++P+PT PR RS RDA+ E+ SPS Sbjct: 499 GGYLPRPTPPRPVYRSRRDATLESELSPS 527 Score = 28.9 bits (63), Expect = 10.0 Identities = 15/28 (53%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +1 Query: 355 GTFIPKPTVPRAENRS-RDASTETVSSP 435 G ++P+PT PR RS RDAS E+ SP Sbjct: 593 GGYLPRPTPPRPVYRSRRDASLESELSP 620 Score = 28.9 bits (63), Expect = 10.0 Identities = 15/28 (53%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +1 Query: 355 GTFIPKPTVPRAENRS-RDASTETVSSP 435 G ++P+PT PR RS RDAS E+ SP Sbjct: 546 GGYLPRPTPPRPVYRSRRDASLESELSP 573 Score = 28.9 bits (63), Expect = 10.0 Identities = 15/28 (53%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +1 Query: 355 GTFIPKPTVPRAENRS-RDASTETVSSP 435 G ++P+PT PR RS RDAS E+ SP Sbjct: 452 GGYLPRPTPPRPVYRSRRDASLESELSP 479 Score = 28.9 bits (63), Expect = 10.0 Identities = 15/28 (53%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +1 Query: 355 GTFIPKPTVPRAENRS-RDASTETVSSP 435 G ++P+PT PR RS RDAS E+ SP Sbjct: 405 GGYLPRPTPPRPVYRSRRDASLESELSP 432 Score = 28.9 bits (63), Expect = 10.0 Identities = 15/28 (53%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +1 Query: 355 GTFIPKPTVPRAENRS-RDASTETVSSP 435 G ++P+PT PR RS RDAS E+ SP Sbjct: 358 GGYLPRPTPPRPVYRSRRDASLESELSP 385 Score = 28.9 bits (63), Expect = 10.0 Identities = 15/28 (53%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +1 Query: 355 GTFIPKPTVPRAENRS-RDASTETVSSP 435 G ++P+PT PR RS RDAS E+ SP Sbjct: 311 GGYLPRPTPPRPVYRSRRDASLESELSP 338 Score = 28.9 bits (63), Expect = 10.0 Identities = 15/28 (53%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +1 Query: 355 GTFIPKPTVPRAENRS-RDASTETVSSP 435 G ++P+PT PR RS RDAS E+ SP Sbjct: 264 GGYLPRPTPPRPVYRSRRDASLESELSP 291 Score = 28.9 bits (63), Expect = 10.0 Identities = 15/28 (53%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +1 Query: 355 GTFIPKPTVPRAENRS-RDASTETVSSP 435 G ++P+PT PR RS RDAS E+ SP Sbjct: 217 GGYLPRPTPPRPVYRSRRDASLESELSP 244 Score = 28.9 bits (63), Expect = 10.0 Identities = 15/28 (53%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +1 Query: 355 GTFIPKPTVPRAENRS-RDASTETVSSP 435 G ++P+PT PR RS RDAS E+ SP Sbjct: 123 GGYLPRPTPPRPVYRSRRDASLESELSP 150 Score = 28.9 bits (63), Expect = 10.0 Identities = 15/28 (53%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +1 Query: 355 GTFIPKPTVPRAENRS-RDASTETVSSP 435 G ++P+PT PR RS RDAS E+ SP Sbjct: 76 GGYLPRPTPPRPVYRSRRDASLESELSP 103
>NFIB_HUMAN (O00712) Nuclear factor 1 B-type (Nuclear factor 1/B) (NF1-B)| (NFI-B) (NF-I/B) (CCAAT-box-binding transcription factor) (CTF) (TGGCA-binding protein) Length = 420 Score = 29.3 bits (64), Expect = 7.7 Identities = 16/47 (34%), Positives = 23/47 (48%) Frame = +1 Query: 349 PLGTFIPKPTVPRAENRSRDASTETVSSPSG*SIETTLLASSTTPSD 489 P G F P P+ P A +R+ + +SSP+ L SS +P D Sbjct: 285 PTGDFYPSPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQD 331
>PER39_ARATH (Q9SUT2) Peroxidase 39 precursor (EC 1.11.1.7) (Atperox P39)| (ATP19a) Length = 326 Score = 28.9 bits (63), Expect = 10.0 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = -1 Query: 406 RGIDFLHEVQSALG*KCQGEVLLARVIWFSAK 311 RG DF+ +V+SAL KC G V A +I + + Sbjct: 98 RGFDFIDKVKSALESKCPGIVSCADIITLATR 129 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 80,843,871 Number of Sequences: 219361 Number of extensions: 1663400 Number of successful extensions: 4476 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 4332 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4475 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4430660157 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
