| Clone Name | rbags3k24 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DRC1A_CHICK (Q5ZM13) Down-regulated by CTNNB1 protein A | 31 | 2.2 | 2 | FBN2_MOUSE (Q61555) Fibrillin-2 precursor | 30 | 6.3 | 3 | R1AB_CVH22 (Q05002) Replicase polyprotein 1ab (pp1ab) (ORF1ab po... | 29 | 8.2 | 4 | FBN2_HUMAN (P35556) Fibrillin-2 precursor | 29 | 8.2 |
|---|
>DRC1A_CHICK (Q5ZM13) Down-regulated by CTNNB1 protein A| Length = 515 Score = 31.2 bits (69), Expect = 2.2 Identities = 17/39 (43%), Positives = 25/39 (64%) Frame = -2 Query: 265 CRGHLARMQTQRGFL*HMPKLVFLRRRRFATSGSVYEPG 149 CR HL+R QTQR ++ +L+ L+R TS S+ +PG Sbjct: 398 CREHLSRKQTQRALSENL-ELLSLKRLTLTTSQSLPKPG 435
>FBN2_MOUSE (Q61555) Fibrillin-2 precursor| Length = 2907 Score = 29.6 bits (65), Expect = 6.3 Identities = 19/65 (29%), Positives = 26/65 (40%) Frame = -3 Query: 222 SNICPSWSFFGGGGLQQVEVCMNQASMGSFCSSCRLVYVCSVRSVLLNCCKMHVFVCAXF 43 S CP W GG V +C N G FCS + CS + C + + C+ Sbjct: 95 SYCCPGWKTLPGGNQCIVPICRNSCGDG-FCSRPNMC-TCSSGQISPTCGRKSIQQCSV- 151 Query: 42 GSKCM 28 +CM Sbjct: 152 --RCM 154
>R1AB_CVH22 (Q05002) Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein)| [Includes: Replicase polyprotein 1a (pp1a) (ORF1a)] [Contains: p9; p87; p195 (EC 3.4.22.-) (Papain-like proteinases 1/2) (PL1-PRO/PL2-PRO); Peptide HD2; 3C-like proteinase (EC 3.4 Length = 6758 Score = 29.3 bits (64), Expect = 8.2 Identities = 18/61 (29%), Positives = 28/61 (45%), Gaps = 1/61 (1%) Frame = +3 Query: 15 SHXXTYISIQXRHKRTHAFCNSSGEQ-IEHYIHTLIYSCCRRNPSKPGSYTLPLVANLLL 191 SH TY+S+ R K + G + Y H + Y R + S PGS++L + + Sbjct: 5613 SHATTYLSLSDRFKTSGDLAVQIGNNNVCTYEHVISYMGFRFDVSMPGSHSLFCTRDFAM 5672 Query: 192 R 194 R Sbjct: 5673 R 5673
>FBN2_HUMAN (P35556) Fibrillin-2 precursor| Length = 2911 Score = 29.3 bits (64), Expect = 8.2 Identities = 19/65 (29%), Positives = 25/65 (38%) Frame = -3 Query: 222 SNICPSWSFFGGGGLQQVEVCMNQASMGSFCSSCRLVYVCSVRSVLLNCCKMHVFVCAXF 43 S CP W GG V +C N G FCS + CS + C + C+ Sbjct: 95 SYCCPGWKTLPGGNQCIVPICRNSCGDG-FCSRPNMC-TCSSGQISSTCGSKSIQQCSV- 151 Query: 42 GSKCM 28 +CM Sbjct: 152 --RCM 154 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 84,034,368 Number of Sequences: 219361 Number of extensions: 1795798 Number of successful extensions: 4257 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4149 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4257 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4757699440 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)