| Clone Name | rbags3k03 |
|---|---|
| Clone Library Name | barley_pub |
>FOXE3_HUMAN (Q13461) Forkhead box protein E3 (Forkhead-related protein FKHL12)| (Forkhead-related transcription factor 8) (FREAC-8) Length = 319 Score = 32.0 bits (71), Expect = 0.93 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -1 Query: 483 SGADPALHPDARTSPLGRATPSPSTGYGQRPHEPQRR 373 +GA+P P+ + G A P+P+ G G+R P +R Sbjct: 33 AGAEPGREPEEAAAGRGEAAPTPAPGPGRRRRRPLQR 69
>PITM1_HUMAN (O00562) Membrane-associated phosphatidylinositol transfer protein| 1 (Phosphatidylinositol transfer protein, membrane-associated 1) (Pyk2 N-terminal domain-interacting receptor 2) (NIR-2) (Drosophila retinal degeneration B homolog) Length = 1243 Score = 30.4 bits (67), Expect = 2.7 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -1 Query: 333 CIENEWTRVETLSIRSFETKTFKFLLFENXKCN 235 C ++EWT + IR+ E +T + L KCN Sbjct: 228 CWQDEWTELSMADIRALEEETARMLAQRMAKCN 260
>BUD3_YEAST (P25558) Bud site selection protein BUD3| Length = 1636 Score = 30.4 bits (67), Expect = 2.7 Identities = 16/66 (24%), Positives = 29/66 (43%) Frame = +2 Query: 185 IRVDNVSNKRSDGLICKLHXLFSNNRNLKVFVSNDRMDNVSTLVHSFSMHHKSIALFTFA 364 +R D + K S ++CKL F ++ ++ ++ R+ T H F L++ A Sbjct: 572 LRFDRLKGKDSFSMVCKLSSAFISSSSVADLITKARILEKDTAFHLFKASRSHFTLYSTA 631 Query: 365 QRHRRC 382 H C Sbjct: 632 --HELC 635
>PTBP2_ARATH (Q9FGL9) Polypyrimidine tract-binding protein homolog 2| Length = 429 Score = 30.0 bits (66), Expect = 3.5 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +2 Query: 218 DGLICKLHXLFSNNRNLKVFVSNDR 292 DG CKLH +S + +L + V+NDR Sbjct: 310 DGGFCKLHITYSRHTDLSIKVNNDR 334
>IBP4_BOVIN (Q05716) Insulin-like growth factor-binding protein 4 precursor| (IGFBP-4) (IBP-4) (IGF-binding protein 4) Length = 258 Score = 29.3 bits (64), Expect = 6.0 Identities = 18/49 (36%), Positives = 23/49 (46%) Frame = +3 Query: 303 FLPSSTHSRCITNQSLCLPLHRGTAAAVHGVVGHSR*KAREWPVPEGLC 449 F P S H R + L R T+ V+G R +AR PVP+G C Sbjct: 128 FSPCSAHDRKCLQKHLAKIRDRSTSGGKMKVIGAPREEAR--PVPQGSC 174
>YQ5B_CAEEL (Q09254) Hypothetical protein C16C10.11| Length = 154 Score = 28.9 bits (63), Expect = 7.8 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -1 Query: 489 RRSGADPALHPDARTSPLGRATPSPSTGYG 400 R + A PA HP A +P+G +PS G G Sbjct: 33 RPAAAAPAYHPPAAPTPMGAPMGAPSQGPG 62
>CHMP7_BRARE (Q6PBQ2) Protein CHMP7| Length = 457 Score = 28.9 bits (63), Expect = 7.8 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = -2 Query: 482 AVPTRPCTPTHAQALWDGPLPRLLPAMANDPMN 384 AVPT P TP L D + LP++ N MN Sbjct: 390 AVPTHPITPPRKTDLPDAAFVQFLPSVPNPGMN 422 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,349,179 Number of Sequences: 219361 Number of extensions: 1428731 Number of successful extensions: 3640 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 3538 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3640 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3478785780 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)