| Clone Name | rbags3h19 |
|---|---|
| Clone Library Name | barley_pub |
>Y081_NPVAC (Q06694) Hypothetical 26.9 kDa protein in GP41-PNK intergenic| region Length = 233 Score = 30.4 bits (67), Expect = 3.5 Identities = 18/40 (45%), Positives = 24/40 (60%), Gaps = 5/40 (12%) Frame = +2 Query: 128 QPPPPSLAMNKVNLPTF--SITKKI*TP---SRITTENFT 232 +PPPP L+M+K PT SI+KKI T R+ +N T Sbjct: 6 RPPPPPLSMSKKETPTLLDSISKKISTTETLQRLRNKNLT 45
>GSPE_PSEAE (Q00512) General secretion pathway protein E (Type II traffic| warden ATPase) Length = 502 Score = 29.6 bits (65), Expect = 6.0 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = +2 Query: 386 PLKEHLEGAGVELVLALLDDDGRRSLRAVQQRDAD 490 P++ HLEG G V A +D R LRA+ ++D D Sbjct: 293 PIEYHLEGIGQTQVNAKVDMTFARGLRAILRQDPD 327
>COMD3_RAT (Q6P9U3) COMM domain-containing protein 3| Length = 195 Score = 29.6 bits (65), Expect = 6.0 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = -2 Query: 484 ISLLHCSEASTAVVIEKGKHKLYSSSLKMLLE 389 + L HC A+ ++E GKH++ S+L LE Sbjct: 57 VVLKHCHGAAATYILEAGKHRVDKSTLSTYLE 88
>COMD3_MOUSE (Q63829) COMM domain-containing protein 3 (Bmi-1 upstream gene| protein) (Bup protein) Length = 195 Score = 29.6 bits (65), Expect = 6.0 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = -2 Query: 484 ISLLHCSEASTAVVIEKGKHKLYSSSLKMLLE 389 + L HC A+ ++E GKH++ S+L LE Sbjct: 57 VVLKHCHAAAATCILEAGKHQVDKSTLSTYLE 88
>HXKG_ASPNG (Q92407) Glucokinase (EC 2.7.1.2) (Glucose kinase) (GLK)| Length = 495 Score = 29.3 bits (64), Expect = 7.8 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = +3 Query: 204 QAESRLRILHNDNRSAYTLPRGEKGGRRGSSVMDGG 311 Q ES LRI HND+ A+ R EK G + D G Sbjct: 116 QIESFLRIHHNDHFEAHLRRRNEKNGNCEEDLFDLG 151
>COMD3_HUMAN (Q9UBI1) COMM domain-containing protein 3 (Bup protein) (PIL| protein) Length = 195 Score = 29.3 bits (64), Expect = 7.8 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -2 Query: 484 ISLLHCSEASTAVVIEKGKHKLYSSSLKMLLE 389 + L HC A+ ++E GKH+ S+L LE Sbjct: 57 VVLKHCHAAAATYILEAGKHRADKSTLSTYLE 88 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,974,818 Number of Sequences: 219361 Number of extensions: 935597 Number of successful extensions: 2502 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2463 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2502 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4528412720 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)