>SCNNH_XENLA (O13263) Amiloride-sensitive sodium channel gamma-2-subunit|
           (Epithelial Na(+) channel gamma-2 subunit) (Gamma-2
           ENAC) (Nonvoltage-gated sodium channel 1 gamma-2
           subunit) (SCNEG2) (Gamma-2 NACH)
          Length = 663

 Score = 31.6 bits (70), Expect = 0.58
 Identities = 14/42 (33%), Positives = 24/42 (57%)
 Frame = +2

Query: 23  NMPHYYFCSINNFNTCTRWTIGKGISANLEHGNVYYS*V*AR 148
           NM  +  C  NN + CT +T G G++A  E   ++Y+ + A+
Sbjct: 202 NMVGFKLCDANNSSDCTIFTFGSGVNAIQEWYRLHYNNILAK 243


  Database: uniprot_sprot.fasta
    Posted date:  May 25, 2006  5:36 PM
  Number of letters in database: 80,573,946
  Number of sequences in database:  219,361
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 32,227,914
Number of Sequences: 219361
Number of extensions: 538060
Number of successful extensions: 1116
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1110
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1116
length of database: 80,573,946
effective HSP length: 52
effective length of database: 69,167,174
effective search space used: 1660012176
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)